Function
E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-119' of histone H2A (H2AK119Ub), thereby playing a central role in histone code and gene regulation. H2AK119Ub gives a specific tag for epigenetic transcriptional repression. Essential component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, rendering chromatin heritably changed in its expressibility.
Sequence
MATPVTAQCSSKTWELSLYELHRTPQAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQDRVLAKLSRLHNQQALSSSIEEGLKMQAMHRAQRVRKHQHESDNTTFSGGEDNCDSRSHVSNPSVHSNQEAGPSRKRSRASEDSGAEPDLSHEGGVRSPDPPGGGENGSEIELVFRAHPLLVEKDGYSQTRYVKTTANATVDHLSKYLALRIALEEEALRGGAEGVTVGEVSEKQYTIYICTGAAGGQYTTLNGSLTLELVNEKYWKISKPLELYYAPTKEQK