Protein
E3 ubiquitin-protein ligase RNF126-B
Function
E3 ubiquitin-protein ligase that mediates ubiquitination oF target proteins. Depending on the associated E2 ligase, mediates 'Lys-48'- and 'Lys-63'-linked polyubiquitination of substrates. Part of a BAG6-dependent quality control process ensuring that proteins of the secretory pathway that are mislocalized to the cytosol are degraded by the proteasome. Probably acts by providing the ubiquitin ligase activity associated with the BAG6 complex and be responsible for ubiquitination of the hydrophobic mislocalized proteins and their targeting to the proteasome.
Sequence
MAEALPEAGRYFCHSCTAEITPRLPEYTCPRCDSGFIEELPETSRNSESNSSNNSGTDQNRPSFENIESAQFTLPSGYGQVTFGIFNEGLDFPMFGTSGPVEETRDGESRREHQSRQRYGARQPRARMSTRRGAGRNEGVPTLEGIIQQLVNGIIAPTAMSNLGVGPWGVLHSNPMDYAWGANGLDTIITQLLNQFENTGPPPADTDKIQALPTIQITEEHVGFGLECPVCKEDYTVGESVRQLPCNHLFHNDCIIPWLEQHDTCPVCRKSLSGQNTATNPPGLTDMTFSSSSTSSSSSTSPTDENNTANNS