About Services Proteins Contact

ribL

Gene
ribL
Protein
FAD synthase
Organism
Methanococcus voltae (strain ATCC BAA-1334 / A3)
Length
174 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
20.126 kDa
Sequence
MIIVIIMPKNENNPNIKNNNHQSPKKRIALTAGTFDLLHPGHFNTLNFAKKHADELVVVLARDETVKRIKGRRPVIPEEQRKIMIETLKPVDKAILGSLTDKLEPILSVKPDIIVLGPDQTTYQLEELKNQLLERGFKTEIVKVEEYVKCPFHSSYDILKEIIRRWCNKEIELK

Gene
ribL
Protein
FAD synthase
Organism
Methanothermobacter marburgensis (strain ATCC BAA-927 / DSM 2133 / JCM 14651 / NBRC 100331 / OCM 82 / Marburg)
Length
161 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
18.664 kDa
Sequence
MKRFSDKRTQIKTVMATGTFDIIHPGHGFFLEEAKKLGGENARLVVVLARDSTVRARKRTPIIGEKQRLEVVMMLKPVDEAYLGSETDMFEIVHRLKPDIIAIGPDQKFDIDELRDELRRRGLECEVKRVGKYRRSELDSTCKIIKKIRKMEFDEDALKNC

Gene
ribL
Protein
FAD synthase
Organism
Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Length
156 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.826 kDa
Sequence
MKTNDKTKKIVLTAGTFDLLHPGHHNTLKYAKSLGDELIVVIARDETVKKIKGRKPVIPENQRREMIEAIKPVDKAILGSLTDKLEPILKIKPDIIVLGPDQITFDAENLKNELKKLGLDVEIVKTKEYTNCDFHSSYDIIKEIVKRWCNKKIIKK

Gene
ribL
Protein
FAD synthase
Organism
Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Length
156 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.822 kDa
Sequence
MIRVVATGTFDILHPGHLWYLEESAKLGDELYVIVARDANIRHKPRPVIPEEQRLVMVAALKPVTHAVLGDLEDMFRPIREIKPDIITLGCNQHFDPETLQKALEKQNIRAQVVRISEHSSSPFTSSRDIVRKIAELTHQRSQTRETKEQRECGAV

Gene
ribL
Protein
FAD synthase
Organism
Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18)
Length
155 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
18.086 kDa
Sequence
MVRVVATGTFDIIHPGHIRFLEEAKKLGDELIVIVAREKNVRHKPKPIIPEEQRVRVVSALKPVDKAILGDEHDIFKPIMELKPDIIALGYDQHFDEKKLEEELRKRGLNTRVVRIKAKEECEYCSSTKIIKRIVDVVKSRLQEYEEFFRSRGML

Gene
ribL
Protein
FAD synthase
Organism
Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34)
Length
153 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.936 kDa
Sequence
MTRVVAQGTFDLLHPGHVHYLEDAATYGDELHAIVARRTNVTHKPAPILCAEQRRDMVAALTAVDEAHLGHPEDVFVPIQRLDPDVIVLGFDQHHDEADIAAALAERGIDCRVERASGRDPRYEDELLSSGDIVDRILKQRGSDCDGAREGQR

Gene
ribL
Protein
FAD synthase
Organism
Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Length
153 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.237 kDa
Sequence
MRRIVATGTFDLLHPGHLFYLQESKKLGDELYVIVARDRNVKHKPRPIIPEEQRLQMVAALKPVDHALLGDTTDMFRPIEAIRPDVITLGFNQNFDPAVLTEALKARSLSAEVVRIGGYGDRVLCSSRRIVQRVIETRGPSLRVGQNTDPEDL

Gene
ribL
Protein
FAD synthase
Organism
Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
Length
153 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.307 kDa
Sequence
MKKVMATGTFDLLHPGHGIYLNEAKKLGGEDAKLYVVIARDSTVEKRKRYPIVGEQQRLELIKMIKGVDEAYLGNENGDFLKIVEEINPDIIAIGADQRHDITKLQKAINKRGLKAKVERVKAYHNAELDSSCKIIKKIKKMDFKGKINDNCD

Gene
ribL
Protein
FAD synthase
Organism
Ferroglobus placidus (strain DSM 10642 / AEDII12DO)
Length
152 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.696 kDa
Sequence
MKKVVATGTFDIIHPGHVRFLEEAKKLGDYLVVIVAREKNVKHKPKPIMPEEQRRRVVEALKPVDEAILGDEEDIFKPIEKIKPDVIALGYDQHFDEEWLREELRKRGIKAEVVRIRAKEDCELCSSAKIIERIVTLASSRLKDFQERKEKL

Gene
ribL
Protein
FAD synthase
Organism
Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7)
Length
152 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.74 kDa
Sequence
MEKDRNVKKRVITAGTFDILHPGHYEILKFAKSLGDELIVIIARDKTVERLKGRKPIIPENQRREMVEALKPVDKAILGSLNNKLEPILKLKPDIIVLGPDQMTFDEETLKKELEKHNLHPKIVRFKNYKKCPFHSSFDIVKEIVKRYCNKE

Gene
ribL
Protein
FAD synthase
Organism
Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Length
151 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.805 kDa
Sequence
MLAGCYPRPGDLLTRVLATGTFDILHPGHVYFLTQARALGDELFVIIARDSNVTHKPKPIVPEEQRLEMVNALGTVDKALLGSEKDMFEPLKEIRPDIIVLGYDQHFDIELLEEELTKRGLPAKVVRVPLSKECPLCSTGAIIKAVLKRYG

Gene
ribL
Protein
FAD synthase
Organism
Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
Length
151 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.859 kDa
Sequence
MLAGYYPSPGDLLTRVLATGTFDILHPGHVYFLAQAKALGDELFVIIARDSNVTHKPKPVIPEEQRLEMVDALKAVNKAILGSEKDMFEPLREIKPDIIALGYDQRFDTEILEKELTKRGLPAKVVRIPLSKECPLCSTGTIIKEVLKRYG

Gene
ribL
Protein
FAD synthase
Organism
Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Length
151 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.308 kDa
Sequence
MSGPSKGRKIRVLVGGVFDILHVGHVHFLKQAKELGDELVVIVAHDETVRRNKRRNPINPAEDRAELLRAIRYVDEVYIGSPGGIDFELVRRINPDVIAIGPDQNFNCEKLKEELKRHGIEAEVIRVPYLYKSDRAKTTKIIRRIVEEFCE

Gene
ribL
Protein
FAD synthase
Organism
Methanocaldococcus sp. (strain FS406-22)
Length
151 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.461 kDa
Sequence
MEKKKIVVTAGTFDILHPGHYEILKFAKSLGDELIVIVARDETVKKLKGRKPIIPEEQRREMVEALKPVDKAVLGSLKNKLEPILKLKPDIIVLGPDQTTFDEETLKQELAKYNLYPEIVRFRGYKKCPFHSSFDIVKEIIRRFCSKEIKI

Gene
ribL
Protein
FAD synthase
Organism
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Length
151 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.417 kDa
Sequence
MKTVMATGTFDIIHPGHGFFLEEARKLGGEDARLVVVLARDSTVRARKRTPIVGEKQRLEVVRMLKPVDEAYLGSETDMFEIVHRIKPDIIAIGPDQKFDVDELRDELRRRGLGCEVRRIEKYRDAELDSTCKIIKRIRSMEFDEDSLKNC

Gene
ribL
Protein
FAD synthase
Organism
Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Length
151 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.469 kDa
Sequence
MDRKKIAVTAGTFDLLHPGHFNTLNFAKKHADELIVIIARDETVKKIKGRRPVIPEEQRKIMIEALKPVDRAVLGSLNDKLEPIININPDIIIIGPDQTTYQINELKRQLLNHGLKPEIIKVEEYVNCQFHSSYDILKEIVRRWCNKELKV

Gene
ribL
Protein
FAD synthase
Organism
Methanohalobium evestigatum (strain ATCC BAA-1072 / DSM 3721 / NBRC 107634 / OCM 161 / Z-7303)
Length
150 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.837 kDa
Sequence
MSLLKLCKGDLLTRVLATGTFDLLHPGHLHYLSEARKLGNELYVIVARESMIKHKPKPVIPENQRVTMVNSLDVVDKAVLGSETNIYEPIKNIKPDVITIGYDQKFSSDSIEKNLEELGINAKVVRINKLSDCSLCSSGKIIDRILERYC

Gene
ribL
Protein
FAD synthase
Organism
Methanocaldococcus fervens (strain DSM 4213 / JCM 15782 / AG86)
Length
150 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.249 kDa
Sequence
MVKKRVVTAGTFDILHPGHYEVLKFAKSLGDELIVIVARDETVKKIKGRKPIIPEEQRREMVEALKPVDKAILGSLKNKLEPILELKPDVIVLGPDQTTFDEETLKEELAKYGLHPEIVRFKGYKKCPFHSSFDIVKEIIRRFCNKEIKI

Gene
ribL
Protein
FAD synthase
Organism
Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Length
150 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.107 kDa
Sequence
MGKRVLAGGVFDILHPGHVAFLEEARKIAGKNGELVVVVARDETVRRLKRTPIVPEEQRVRMVSALKPVDRAILGHPRDFSITLKTVKPDVVVLGPDQDIDEKEVERWAERAGVDCEVRRIEKYERCPLDSTIKIVKRVIELWKRGELRV

Gene
ribL
Protein
FAD synthase
Organism
Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
Length
150 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.259 kDa
Sequence
MEKKIAVTAGTFDLLHPGHFNTLNFAKKHADELVVIIARDETVKKIKGRSPVIPEEQRKVMIEALKPVDRAVLGSLTNKLEPILEIRPDVIILGPDQTTYQINELKSQLAKHFLYPEILKVEEYVKCPFHSSYDILKEIVRRWCCKELKV

Gene
ribL
Protein
FAD synthase
Organism
Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
Length
150 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.304 kDa
Sequence
MEKKIAVTAGTFDLLHPGHFNTLNFAKKHADELVVIIARDETVKKIKGRSPVIPEEQRKIMIETLKPVDRAVLGSLNDKLEPILEIRPDVIILGPDQTTYQINELKSQLAEHFLYPEVLKVEEYVKCPFHSSYDILKEIVRRWCCKELKV

Gene
ribL
Protein
FAD synthase
Organism
Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
Length
150 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.258 kDa
Sequence
MEKKIAVTAGTFDLLHPGHFNTLNFAKKHADELVVIIARDETVKKIKGRSPVIPEEQRKIMIEALKPVDRAVLGSLTNKLEPILEIRPDIIVLGPDQTTYQITELKSQLAKHFLYPEVLKVEEYVRCPFHSSFDILKEIVRRWCCKELKV

Gene
ribL
Protein
FAD synthase
Organism
Methanococcus maripaludis (strain S2 / LL)
Length
150 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.17 kDa
Sequence
MEKKIAVTAGTFDLLHPGHFNTLNFAKKHADELVVIIARDETVKKIKGRSPVIPEEQRKIMIEALKPVDRAVLGSLTNKLEPILEIRPDVIVLGPDQTTYQINELKAQLAEHSLYPEILKVEDYVKCPFHSSYDILKEIVRRWCCKELKV

Gene
ribL
Protein
FAD synthase
Organism
Thermococcus onnurineus (strain NA1)
Length
150 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.376 kDa
Sequence
MEKRERKKIRVLAGGVFDLLHVGHIHFLSQAKSLGDELVVIVAHDETVRMQKRREPVNPAEDRAELLRALKMVDEVYIGSPGTIDYELVRKINPDIVAIGPDQRFSCERLKEELRKHGINSEVIRIPYLYKEDRAKTSKIIQRIVETYCE

Gene
ribL
Protein
FAD synthase
Organism
Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1)
Length
150 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.979 kDa
Sequence
MKVMATGAFDILHPGHGLYLEKAKELGGEDAVLAVVIARDSTVKKKKRIPVIDENQRLEMIKYLKPVDEAYIGHDGDMFEIVEEIKPDIIAIGFDQGHDVNKLQEELDKRGIKAKAMRVEAHRIADLDSTCKIIKKIRNSDFEEDYVNCD

Gene
ribL
Protein
FAD synthase
Organism
Aciduliprofundum boonei (strain DSM 19572 / T469)
Length
149 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.38 kDa
Sequence
MVRVMATGVFDILHPGHVLFLREARKLGDELVVVVARDSTVERLKHKPIMNEDIRRFMVESLKPVDRAVLGHKDDMYKTVEDVRPDIIVLGYDQKFDEKEIEEECRKRGIKVKVVRLKKYGDSDLNGTRKIIFKIVDRVDDLYAKDRNS

Gene
ribL
Protein
FAD synthase
Organism
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Length
149 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme. To a lesser extent, is also able to utilize other nucleotides such as CTP and GTP as substrates, producing the modified coenzymes, flavin cytosine dinucleotide (FCD) and flavin guanine dinucleotide (FGD), respectively. Does not catalyze the reverse reaction to produce FMN and ATP from FAD and PPi. Does not function as a glycerol-3-phosphate cytidylyltransferase, as previously annotated in the complete genome.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.288 kDa
Sequence
MKKRVVTAGTFDILHPGHYEILKFAKSLGDELIVIVARDETVKKLKGRKPIIPEEQRREMVEALKPVDKAILGSLKNKLEPILELKPDIIVLGPDQTTFDEETLKKELAKYNLYPEIVRFRGYKKCPFHSSFDIVKEIIRRFCNKEIKI

Gene
ribL
Protein
FAD synthase
Organism
Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Length
149 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.911 kDa
Sequence
MIRVVATGTFDILHPGHLYYLEESRNLGDELSVIVARDANVKHKPRPFLPEDQRLRMIRALKPVDHALLGDLHDMFRPIAEIRPDIITLGFNQHFDEEHLRQKLRERGLDADVVRIPGYPGSLASSSKIIERILNTRGPPDPTGSHGEE

Gene
ribL
Protein
FAD synthase
Organism
Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Length
149 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.304 kDa
Sequence
MEEKRKKIRVLVGGVFDILHVGHIHFLKQAKELGDELVVIVAHDETVRMQKRREPINPAEDRAELLRAIRYVDEVYIGTPGTIDMELVKRIDPDVIAIGPDQFFNCEKLKEELRKHGINAEVIRIPYLYKSDRAKTSKIIQRIVETFCE

Gene
ribL
Protein
FAD synthase
Organism
Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
Length
148 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.674 kDa
Sequence
MTARRVVATGTFDILHPGHVYYLTESRKLGDELWVIVARDENVKHKPRPILPEAQRLAMVSALRPVDHAILGDHTDMFCPIDDIRPAVITIGFNQYFDEEKLKGQLAERNLPAEVVRIGKYEDGDLASSRMIVQRIVEARGSGDQRIG

Gene
ribL
Protein
FAD synthase
Organism
Thermococcus sibiricus (strain MM 739 / DSM 12597)
Length
148 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.783 kDa
Sequence
MTKKKKIRVVTGGVFDILHVGHIHFLKQAKELGDELVVIVAHDKTVEERKGRRPINSMYERAEVLKALKMVDEVVIGEPNCISFEIVKQLNPDIIALGPDQNFDVSALKEELKKKNINAEVIRIPYAYKSDVAKTSKIIQKIVETFCE

Gene
ribL
Protein
FAD synthase
Organism
Methanolacinia petrolearia (strain DSM 11571 / OCM 486 / SEBR 4847)
Length
148 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
17.131 kDa
Sequence
MKRIVATGTFDILHPGHIYYLEESRKLGDELHVIIARDENVRHKPKPVIPEQQRLRMVQSLKPVDYARLGSTTDIFEPIREIQPDIITLGFNQFFNEEKLKCDLEENGISAEVVRIEGYSGEGFCSSRNIMKQILIRRCKELQDDSTD

Gene
ribL
Protein
FAD synthase
Organism
Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Length
148 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.744 kDa
Sequence
MASGTFDIIHPGHGFYLSESKKLGGDNAILMVVVATDKTVKNHKRVPIVGEKQRCEMVSMLKGVDEAYVGDEKDPFKIVKEKKPDIITIGPDQNFNPDSLHKSLLKKGLDIKVVKINDYKKFELDSSCKIIRKIKQTDFDMDYLENCQ

Gene
ribL
Protein
FAD synthase
Organism
Natrialba magadii (strain ATCC 43099 / DSM 3394 / CIP 104546 / JCM 8861/ NBRC 102185 / NCIMB 2190 / MS3)
Length
148 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.707 kDa
Sequence
MTNDNPRTVIAQGTFDLLHPGHVHYLEEAAAMGDELYVIVARKSNVDHKKAPICSAAQRRDVVDALEVVDEAILGHEEDIFVPIERIDPDVIALGHDQHHDADAIEDELERRGIDCVVDRASGRESTREDEVLSTRLIIDRILERRDR

Gene
ribL
Protein
FAD synthase
Organism
Pyrococcus abyssi (strain GE5 / Orsay)
Length
148 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.833 kDa
Sequence
MAGNRRIRVVVGGVFDILHVGHIHFLKMAKELGDELIVIVAHDETVKKRKGRPPINPAEDRAEVLRAIRYVDDVVIGEPGEISLELIKKLKPDVIALGPDQDFDCRTLKEKLRSIGLKVEVIRLPYLYKEDRAKTSKIIKRITEIFCD

Gene
ribL
Protein
FAD synthase
Organism
Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Length
148 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.852 kDa
Sequence
MGDNRKVRVVVGGVFDILHVGHVHFLKMAKELGDELIVIVAHDETVKRRKGRPPINPAEDRAELLKSIRYVDDVVIGEPGEISIDLIKRLKPDVIALGPDQDFSCEELKKRLRKEGINAEVIRLPYLYKSDRAKTSKIIQRIIETFCE

Gene
ribL
Protein
FAD synthase
Organism
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Length
148 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.737 kDa
Sequence
MGSDRKIRVVVGGVFDIIHAGHVHFLKMAKELGDELIVIVAHDETVKKRKGRPPINPAEDRAEVLKAIRYVDDVVIGKPGEISLDLIKRLKPDVIALGPDQDFDCEDLKRKLKSIGLNVEVIRLPYLYKKDRAKTSKIIERITEIFCD

Gene
ribL
Protein
FAD synthase
Organism
Korarchaeum cryptofilum (strain OPF8)
Length
147 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.874 kDa
Sequence
MLEMGRRVMVAGTFDIIHEGHIKMLWSAKSLAGDDGELVVVVARDENVRKYKKREPILEESIRAYIVKNLKPVDRVVLGERDPIESVLKLRPDVIALGYDQWADENWLREELLKRGLNVEIVRLPRFGDSSSSSIVRRVIKLFCSSE

Gene
ribL
Protein
FAD synthase
Organism
Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Length
146 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.002 kDa
Sequence
MTRVVAQGTFDLIHPGHVHYLEDAAAMGDELHVILARRENVTHKDPPVLPNRQRRDVVAALDPVDHARIGHPEDIFAPIEAIDPDVIALGFDQHHDAAAIEAELADRGLDCAVERASPREARYDDEVLSSGDIADRVLAQRGDSDP

Gene
ribL
Protein
FAD synthase
Organism
Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
Length
146 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.002 kDa
Sequence
MTRVVAQGTFDLIHPGHVHYLEDAAAMGDELHVILARRENVTHKDPPVLPNRQRRDVVAALDPVDHARIGHPEDIFAPIEAIDPDVIALGFDQHHDAAAIEAELADRGLDCAVERASPREARYDDEVLSSGDIADRVLAQRGDSDP

Gene
ribL
Protein
FAD synthase
Organism
Methanothermus fervidus (strain ATCC 43054 / DSM 2088 / JCM 10308 / V24 S)
Length
145 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.66 kDa
Sequence
MATGTFDIIHPGHGFYLKKAKELGGKNSKLVVIVARDSTVRARKRKPVINEKQRLEVVKMLKPVDEAYLGCEGDIFKTVEKIKPDIIALGPDQDFDEKELQKELKKRNIDCKVVRIKEYKKSPLDSTCKIIKKIKQMKFDDIEKC

Gene
ribL
Protein
FAD synthase
Organism
Methanocaldococcus infernus (strain DSM 11812 / JCM 15783 / ME)
Length
145 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.745 kDa
Sequence
MKRVVAAGTFDILHPGHYEFLKFAKSLGDELIVIVARDKTVEKIKGRKPIIPEEQRRAMVEALKPVDKAILGSLNNKLEPIIELKPDIIVLGPDQRTFDEEELKRELKKYDLSPKIVRFNKYIKCPFHSSYDIVKEILKRYGGKE

Gene
ribL
Protein
FAD synthase
Organism
Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541)
Length
143 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.018 kDa
Sequence
MVTRDVVAQGTFDILHPGHVHYLREAKAMGDRLHVIVARSENVTHKAPPVVPDRQRVEMVEALDPVDYARLGHAEDIFVPIEQIEPDVIALGYDQHHEVEGIETALDERGLDCEVRRAGPRKASEDEILSTGSIIEKILDERS

Gene
ribL
Protein
FAD synthase
Organism
Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734)
Length
143 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
15.939 kDa
Sequence
MTRTVIAQGTFDILHPGHVHYLEEAAAMGDELLVIVARKSNVDHKEKPICPAAQRRDVVAALEAVDDAIVGHEEDIFAPIEAIDPDVIALGHDQHHDDDAIEAELERRGIDCTVERASAREPEREDEILSTRLIIDRILERRG

Gene
ribL
Protein
FAD synthase
Organism
Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Length
143 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.148 kDa
Sequence
MTRVLATGTFDLLHPGHVFFLRQARSFGDELYVLVARDSMIKHKAQPIVPEGQRLKMISAFGVVDKALLGSESDIFEPLKEINPDIIVLGHDQFFDTGELEKNLGERGFKAKVVRIDDAMKCELCSSGRIIKRVLERYGQNEE

Gene
ribL
Protein
FAD synthase
Organism
Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
Length
143 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.445 kDa
Sequence
MRGTMTRVMATGTFDILHPGHLLYLERSRALGDELVVVVARDINVKHKPRPVVPEDQRLRMVSALKMVDMAVLGSVTDIFEPVRALRPDIITLGYDQYMDENWLEGELRKRGLMARVVRISEREPCELCSSRQIVEKILKERC

Gene
ribL
Protein
FAD synthase
Organism
Halalkalicoccus jeotgali (strain DSM 18796 / CECT 7217 / JCM 14584 / KCTC 4019 / B3)
Length
142 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
15.831 kDa
Sequence
MVRALAQGTFDLLHPGHIHYLEEAARMGDELYVIVARSANVTHKRAPVLDGRQRRDMIGALEVVDHALLGHESDIFVPIEEIDPDVIVLGHDQHHDEAAIERALGDRGIDCGVRRASPRDPAYDGELLSTGRIVDRICERRC

Gene
ribL
Protein
FAD synthase
Organism
Halorhabdus utahensis (strain DSM 12940 / JCM 11049 / AX-2)
Length
142 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
15.892 kDa
Sequence
MTTVVAQGTFDLLHPGHLHYLREAAGMGDQLHVILARRENVTHKDPPILPNEQRREMVAALDPVDEAIVGHDDDIFIPVERIDPDLLVLGYDQHHDRGDIADALAERGIDCVVRRASEYEPGYEGAVLSTGRIVERILETRD

Gene
ribL
Protein
FAD synthase
Organism
Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Length
142 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
15.973 kDa
Sequence
MRRVIAQGTFDILHPGHVHYLSDAASLGDELHVIIARGENVTHKPKPILDGRQRRDMVAALDVVDEAHLGHVEDIFVPIEEIDPDVIVLGYDQHHDEDGIKAALDARGIDCEVTRATPRELRHDDELLSTGRIIDRIVERRC

Gene
ribL
Protein
FAD synthase
Organism
Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Length
142 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.196 kDa
Sequence
MVRVMATGVFDIIHLGHIHYLRESKKLGDELVVVVARDSTARKNGKVPIFDENSRLKLVSELKPVDRAILGHEDDMMKTVVEVMPDIITLGYDQKFDEADLKRKLDQIGVNSRIVRISKYDGNLNSSSMVRKKIMELIGERF

Gene
ribL
Protein
FAD synthase
Organism
Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
Length
142 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.009 kDa
Sequence
MIRVMATGVFDILHLGHIHYLKESKKLGDELVVVVARDSTARNNGKIPIFDENSRLALISELKVVDRAILGHEGDMMKTVIEVKPDIITLGYDQKFDEAELQSKINKLGITVKIVRISKYDGQLNSSSSVRKKIMELIGERY

Gene
ribL
Protein
FAD synthase
Organism
Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP)
Length
142 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.484 kDa
Sequence
MTRILATGTFDILHPGHLYYLEQARKYGNELYVLVARDSTIEHKPKPIVPEKQRLEMVKALRVVDHALLGSEEDMFKPLKEVQPDIIVLGHDQVFDEKELEDKLQKRGFNTKVVRLGKPHQCTLCSSGRIIKRILERKRTEL

Gene
ribL
Protein
FAD synthase
Organism
Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50)
Length
140 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.189 kDa
Sequence
MVRRVVATGTFDILHPGHVLYLCEARKHGDELWVIVARESTIKHKRKPLIPEEQRLFMVQSLKCVDHAVLGSETDMFEPIRQIQPEVIAIGFNQHWNENELKKQLAERGIKAEIVRIQTSDHSPYASSRTIRQKIKESDP

Gene
ribL
Protein
FAD synthase
Organism
Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Length
140 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.123 kDa
Sequence
MKKIVATGTFDILHPGHIYYLEESKKLGDELWVIVAREKNVVHKPRPIVSEDQRLKMIQSLKCVDHAVLGDQTDMYKPIREIDPAVITIGFNQKWSEEKLRADLAERNICADVVRISEYTGMPFTSSTKIIDEAVRRRTK

Gene
ribL
Protein
FAD synthase
Organism
Natronomonas pharaonis (strain ATCC 35678 / DSM 2160 / CIP 103997 / NBRC 14720 / NCIMB 2260 / Gabara)
Length
140 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
15.806 kDa
Sequence
MRRVVAQGTFDLLHPGHLYYLTEAKSMGDELHVIVARSQNVTHKQPPIVPDEQRREMVAGLDPVDSARLGHTDDFFVPIRDIDPDVIVLGHDQHHDDERLAEMLTEEGIDCEVARASARDGDDKILSTGRIVDRICEERC

Gene
ribL
Protein
FAD synthase
Organism
Methanosarcina barkeri (strain Fusaro / DSM 804)
Length
139 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
15.549 kDa
Sequence
MTRILATGTFDLLHPGHIYFLTQARALGDELFVIVARDSNVTHKPKPIVSEEQRLEMVNALGIVDKALLGSEKDMFEPLKHIRPDIIALGYDQRFNAENLEEELAKRGLPANVVRIPLSKECPLCSTGAIIKEVLKRYG

Gene
ribL
Protein
FAD synthase
Organism
Methanocella paludicola (strain DSM 17711 / JCM 13418 / NBRC 101707 / SANAE)
Length
139 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
15.924 kDa
Sequence
MTRVVATGTFDILHPGHVLYLSEAGKLGDELYVIVARDSTIKHKRKPLVPENQRLFMVRALKCVDHAMLGSEDDMFKPIREIDPDIITIGFNQHWDEEALQRQLIERGLKAKVVRITKCDTAPYASSRHIREKIKESDC

Gene
ribL
Protein
FAD synthase
Organism
Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828)
Length
139 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.169 kDa
Sequence
MKIMATGVFDILHPGHIHYLSESKKLGDYLIVIIATDKTAGSHGKKLIFNEEQRRFMVSQLRMVDEAIIGHEDDIFKTVYEVRPDIITLGYDQHFNDSEIEKKCRDLGLNTRVVRISKYDGEIKSSSDIRRRIIELYNR

Gene
ribL
Protein
FAD synthase
Organism
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Length
137 amino acids
Function
Catalyzes the transfer of the AMP portion of ATP to flavin mononucleotide (FMN) to produce flavin adenine dinucleotide (FAD) coenzyme.
Similarity
Belongs to the archaeal FAD synthase family.
Mass
16.06 kDa
Sequence
MATGTFDIIHPGHITFLREAKKLGDELIVIVAREKNVRHKPKPVVPEEQRRRVVEAIKYVDKAILGDEDDMFRPIMELKPDVIVLGHDQHFDEDWLKEELRKRNLNCEVVRIRVKEDCPLCSSHKIIERILEKYGGR