Rbfa

Putative ribosome-binding factor A, mitochondrial

350 amino acids

Belongs to the RbfA family.

39.317 kDa

MWAGVAGLRGSCAGLQALWGGHRAALLLGRSPALHTSVASCGSKNLLKKFASKTRKKFWYEGPSLGSHLTPRPSKHEFLTKTTSKKTRKEDSIRLRVLNGLLYKSLTELLCTPQVSQEVYDLNVELSKVSVTSDFSACRVYWKTGVSAEQNKHTESVLQRSAAYMRHLLISQQTLRNVPPIVFVQDKRDLVLAEVDRLLAEADFGPPDERDDLDGLRNADAQVPHDSPEPAAHPNLCGIDHEALNKQIMEYKRKKERGLQCQSLAPPSGREQAPEPTRLLRKREKVRSRWQHRDASPRSFLLGEEDEDEDSSTEWECHAHEAEDDDDHQEEELGADRGAQRGLCGKREQG

RBFA

Putative ribosome-binding factor A, mitochondrial

343 amino acids

Belongs to the RbfA family.

38.359 kDa

MWAAAGGLWRSRAGLRALFRSRDAALFPGCERGLHCSAVSCKNWLKKFASKTKKKVWYESPSLGSHSTYKPSKLEFLMRSTSKKTRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDLNVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQTLRNVPPIVFVQDKGNAALAELDQLLAVADFGPRDERDNFVQNDFRDPDAPQPCGTTEPTTSSSLCGIDHEALNKQIMEYKRRKDKGLGGLVWQGQVAELTTQMKKGRKRAKPRLEQDSSLKSYLSGEEVEDDLDLVGAPEYECYAPDTEELEAERGGGRTEDGHSCGASRE

rbfA

Ribosome-binding factor A

203 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

22.071 kDa

MADPARARKLAVRIREVVASALERGVKDPRLGMVTVTEVRVTPDLVDATVFYTVYGDEDARRASAEALESARGLLRSQVGRATGVKVTPTLTFVHDRLPDDAKHLEDLISVARERDARLAEVRRDARPAGDEDPYRRPRTVDEDDEDEDEDLVDEFDEFDRVEELDADAGDALGGDAGAREAGASAGRQVYPASPGGDPTAGR

rbfA

Ribosome-binding factor A

196 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

21.76 kDa

MDRVKEFAMKDQIRAHRMAGRIRHLISRQIETKLRDQLGLVTITEVQVTGDLHHAKVFVTVYGTKDEAQTALKILEDNRANFRRSLGVLKVRFVPTVEFELDRLFEDAGIMDELIQRARESDKRIAAGASGPIDNDATALMDKVVDQEARNPDSWHTAPTSSSHTAGLCLVRASSPIACNIDSTTLCKPRTPGPGL

rbfA

Ribosome-binding factor A

196 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

21.76 kDa

MDRVKEFAMKDQIRAHRMAGRIRHLISRQIETKLRDQLGLVTITEVQVTGDLHHAKVFVTVYGTKDEAQTALKILEDNRANFRRSLGVLKVRFVPTVEFELDRLFEDAGIMDELIQRARESDKRIAAGASGPIDNDATALMDKVVDQEARNPDSWHTAPTSSSHTAGLCLVRASSPIACNIDSTTLCKPRTPGPGL

rbfA

Ribosome-binding factor A

183 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.998 kDa

MADAARARRLAKRIAAIVASAIEYEIKDPGLAGVTITDAKVTADLHDATVYYTVMGRTLHDEPNCAGAAAALERAKGVLRTKVGAGTGVRFTPTLTFTLDTISDSVHRMDELLARARAADADLARVRVGAKPAGEADPYRDNGSVAQSPAPGGLGIRTSDGPEAVEAPLTCGGDTGDDDRPKE

rbfA

Ribosome-binding factor A

183 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.998 kDa

MADAARARRLAKRIAAIVASAIEYEIKDPGLAGVTITDAKVTADLHDATVYYTVMGRTLHDEPNCAGAAAALERAKGVLRTKVGAGTGVRFTPTLTFTLDTISDSVHRMDELLARARAADADLARVRVGAKPAGEADPYRDNGSVAQSPAPGGLGIRTSDGPEAVEAPLTCGGDTGDDDRPKE

rbfA

Ribosome-binding factor A

183 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.998 kDa

MADAARARRLAKRIAAIVASAIEYEIKDPGLAGVTITDAKVTADLHDATVYYTVMGRTLHDEPNCAGAAAALERAKGVLRTKVGAGTGVRFTPTLTFTLDTISDSVHRMDELLARARAADADLARVRVGAKPAGEADPYRDNGSVAQSPAPGGLGIRTSDGPEAVEAPLTCGGDTGDDDRPKE

rbfA

Ribosome-binding factor A

183 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.998 kDa

MADAARARRLAKRIAAIVASAIEYEIKDPGLAGVTITDAKVTADLHDATVYYTVMGRTLHDEPNCAGAAAALERAKGVLRTKVGAGTGVRFTPTLTFTLDTISDSVHRMDELLARARAADADLARVRVGAKPAGEADPYRDNGSVAQSPAPGGLGIRTSDGPEAVEAPLTCGGDTGDDDRPKE

rbfA

Ribosome-binding factor A

183 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.998 kDa

MADAARARRLAKRIAAIVASAIEYEIKDPGLAGVTITDAKVTADLHDATVYYTVMGRTLHDEPNCAGAAAALERAKGVLRTKVGAGTGVRFTPTLTFTLDTISDSVHRMDELLARARAADADLARVRVGAKPAGEADPYRDNGSVAQSPAPGGLGIRTSDGPEAVEAPLTCGGDTGDDDRPKE

rbfA

Ribosome-binding factor A

183 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.998 kDa

MADAARARRLAKRIAAIVASAIEYEIKDPGLAGVTITDAKVTADLHDATVYYTVMGRTLHDEPNCAGAAAALERAKGVLRTKVGAGTGVRFTPTLTFTLDTISDSVHRMDELLARARAADADLARVRVGAKPAGEADPYRDNGSVAQSPAPGGLGIRTSDGPEAVEAPLTCGGDTGDDDRPKE

rbfA

Ribosome-binding factor A

175 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.566 kDa

MADPARARRLAKRITTIVASAIEYEIKDPGLVGVTITDAKVTADLHDATVYYTVMGPTLDDEPDYAAAAAALERAKGVLRTKVGAGTGVRFTPTLTFTRDVTSDTVHRMDELLARARAADADLARVRVGAKPAGEADPYRDRGSADEPSDAGGLVIRTSDGLEAENTGDDYQAED

rbfA

Ribosome-binding factor A

175 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.536 kDa

MADPARARRLAKRITTIVASAIEYEIKDPGLVGVTITDAKVTADLHDATVYYTVMGPTLDGEPDYAAAAAALERAKGVLRTKVGAGTGVRFTPTLTFTRDVTSDTVHRMDELLARARAADADLARVRVGAKPAGEADPYRDRGSVDEPSDAGGLVIRTSDGLEAENTGDDYQAED

rbfA

Ribosome-binding factor A

175 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.955 kDa

MADPARAAKLAQRIKVVVAEALGRKVKDPRLEGVTVTDARVTNDLQHATVYYTVFGDETAHADAAKGLEKAKGVLRQEVGRNITVRLTPTLEFVADQIPVVASNLEELLREARKRDAEVAALAATAKHAGEADPYKSDAPEDVDIDEDDFDEEDIDLAGDDDIDEDANKDADSSK

rbfA

Ribosome-binding factor A

171 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.387 kDa

MADPARAKRLAKRISTIVASAIEYEIKDPRLAGVTITDSKVTNDLHDATLYYTVLGRSLDEEPDYAGAAAALEKAKGVLRTKVGAGTGVRFTPTLAFVRDTVPDTAHRMEELLARARAADEDLARVREGAKHAGDADPYRVSGVEEEAGGSGEVQAEFDAEDTGDRNRQDD

rbfA

Ribosome-binding factor A

171 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.387 kDa

MADPARAKRLAKRISTIVASAIEYEIKDPRLAGVTITDSKVTNDLHDATLYYTVLGRSLDEEPDYAGAAAALEKAKGVLRTKVGAGTGVRFTPTLAFVRDTVPDTAHRMEELLARARAADEDLARVREGAKHAGDADPYRVSGVEEEAGGSGEVQAEFDAEDTGDRNRQDD

rbfA

Ribosome-binding factor A

171 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.387 kDa

MADPARAKRLAKRISTIVASAIEYEIKDPRLAGVTITDSKVTNDLHDATLYYTVLGRSLDEEPDYAGAAAALEKAKGVLRTKVGAGTGVRFTPTLAFVRDTVPDTAHRMEELLARARAADEDLARVREGAKHAGDADPYRVSGVEEEAGGSGEVQAEFDAEDTGDRNRQDD

rbfA

Ribosome-binding factor A

171 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.597 kDa

MADPTRARKLADRIKVIVADALEKRVKDPRLGFVTITDARVTNDLQHATLFYTVFGSDEEKQGTALALESAKGVLRSEVGKRTGIRLTPTLTFTLDEVPETATQIQDLLKQAAEQDARVAALAAAAQPAGDPDPYKKPVDHTDDWDEDDEDDRDGDDAVDALDAAADVPRL

rbfA

Ribosome-binding factor A

170 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.586 kDa

MVDHARARKMADRIKEIVARKLDRGIKDPRLGFVTVTDVRVTGDLQHASIFYTVYGTDEERADTAAALKSATGMLRSEVGKNITARLTPSLEFILDGVPENAAAIDALLEEARRRDADVQAQAKAGVYAGDEDPYVKPRVIGEDEDDDDEEGDEDGDDVDRSAPGYEPAH

rbfA

Ribosome-binding factor A

169 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.452 kDa

MADPARAAKLAQRIKVVVAEALGRKVKDPRLEGITVTDARVTNDLQHATIYYTVFGDQVVQADAAKGLEKAKGVLRQEVGRNITVRLTPTLEFVADQIPVNASNLEELLRAAKKRDAEVAALAAGAKHAGDADPYKSDIPEDVEIDEDDFDEEDEDLIDDEELDEDGNK

rbfA

Ribosome-binding factor A

168 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.515 kDa

MADPARARRLAVRIREVVASTLERGVKDPRLGMVTVTDVRLTPDLVDATVFYTVYGDETARQASAQALESARGLLRSQVGRATGVKVTPTLTFVHDRLPDDAQHLEKLISVARERDAYLAEVRRDARPAGDDDPYRRPRPAAGEVDELSEVDELSEVDEYGGTARQEG

rbfA

Ribosome-binding factor A

168 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.837 kDa

MPDPARAKRLAKRISTIVASAIEYEIKDPRLAGVTITDAKVTNDLHDATLYYTVLGRSLDEEPDYEGAAAGLEKAKGVLRTKVGASLGVRFTPTLAFARDTVPDAAHRMEALLAQARAADEDLARVREGAKHAGDSDPYRVLGEGDLEGPATGGPDVEDEGGANSHDR

rbfA

Ribosome-binding factor A

167 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.244 kDa

MADPARAAKLAQRIKVVVAEALGRRVKDPRVESITVTDARVTNDLQHATIYYTVFGDDVAQADAARALEKAKGVLRQEVGRNITVRLTPTLEFVADQIPVNASNLEELLREAKRRDAEVAALAASAKHAGEADPYKGDSPEDIDEDDFDEEDTDLSGDNDLDEDANR

rbfA

Ribosome-binding factor A

167 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.785 kDa

MAGTNPRAARIAALIQRVIASSMEAQLHDKRLANVTITEVRVTNDLQIAKVYWTQLGHEGHEQGERRRAQQALNQAKGRLRSLVGTKAGLRLTPQLEFIFDEVPGEAHEIEDILALAHKRDEELAKSRANAQYAGDADPYKHDEPDDDDFDDDDDVEVEDWDDDDEA

rbfA

Ribosome-binding factor A

166 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.766 kDa

MADTARARRLAKRIAQIVASGLEYEVKDPRLAMVTITDARVTPDLRDATVYYTVFGDDADHASTAAALASATGVLRSRVGQQTGVRFTPTLTFVADTVPDDARRLDELLAQAREADAEVARLASTAEHAGDADPYRVDTEDDDDDTDGADAEARSDADVRRGPQSG

rbfA

Ribosome-binding factor A

166 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.2 kDa

MVDHARARKMADRIKEIVARKLDRGIKDPRLGFVTVTDVRVTGDLQHASIFYTVYGTDEERADTAAALKSATGMLRSEVGKNITARLTPSLEFILDGVPENAAAIDALLEEARRRDADVQAQAKSGVYAGDEDPYVKPRVIGEDEDEDDEDGDDIDRSAPGYEPAH

rbfA

Ribosome-binding factor A

166 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.714 kDa

MREFSRTDRVAQQIQKEIAVILQREIKDPRLGMVTVSAVEVSRDLSYAKIFITVFNTQDDNAAKQSANVLNEATGYIRSLLGKRIRARIMPELKFLVDNSLMEGMRISNLVDSIIREDNAKHVADETDVEDSTDHEDDVTNSEDETKHVDIDTDSEEGTNTDGKAQ

rbfA

Ribosome-binding factor A

164 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

18.189 kDa

MKRHSENKKSGPVGPSQRQLRAGELIRHALVDILREEDLVDPALAGISVTISEVRMSADLKHAICFVEPLGASIAPQVEREPSSPSRTVVVPGSPAEVVAGLTRLTKFLRGKLAKTIDMKFTPELKFLHDETFNSATYMDRLFEDPRVQQDVRRLSDVAEDEEG

rbfA

Ribosome-binding factor A

164 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.483 kDa

MADQARARRLAKRICTIVASAIEFEIKDPGLDGVTIVDVKVTADLHDATVFYTVMGRTLEDAPDYTAATAALNRAKGTLRSKVGAGTGVRFTPTLTFIRDTTSDSVARMEELLARARAADADVAQVRLRAKPAGEADPYRDKGSVAGLVGVDIADIDDDDLTDD

rbfA

Ribosome-binding factor A

164 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.483 kDa

MADQARARRLAKRICTIVASAIEFEIKDPGLDGVTIVDVKVTADLHDATVFYTVMGRTLEDAPDYTAATAALNRAKGTLRSKVGAGTGVRFTPTLTFIRDTTSDSVARMEELLARARAADADVAQVRLRAKPAGEADPYRDKGSVAGLVGVDIADIDDDDLTDD

rbfA

Ribosome-binding factor A

164 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.855 kDa

MTRTSDKAPTQRQLRVGEEIRHALAEVFERGTVRDPAVAGVALTVTEVRISPDLRNATVFLVRLGGGPLDEVLTGLRKARAFLRREVAIRIHTKFVPDLRFESDPSFDYAEYINGLLHRPEVARDLGVPPSGEDDGDDEADDEDDDGGEEGPGAAAPPPADEGR

rbfA

Ribosome-binding factor A

163 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.355 kDa

MADPARAKRLAKRISTIVASAIEYEIKDPRLAGVTITDAKVTNDLHDATLYYTVLGRSLDEEPDYEGAAAGLEKAKGVLRTKVGASLGVRFTPTLAFARDTVPDTAHRMEALLAKARAADEDLARVRQGARHAGEADPYRVTGAEDEASGDAEDEGGSNSLDD

rbfA

Ribosome-binding factor A

162 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.186 kDa

MPDPARARRLAKRINTIVASAIEFEIKDPGLDGVTIVDTKVTADLHDATVFYTVMGRTLDDEPDYGAAAAALERAKGALRTMVGAGTGVRFTPTLTFTRDTTSDSVARMDELLARARAADADLARVRSGAKPAGEADPYRESGSGVEPGRDGSIGDDDQPEY

rbfA

Ribosome-binding factor A

162 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.563 kDa

MSNPRIRKIADRIQVVVAEMLERRIKDPRLGFVTVTDVRVSGDSQQATIFYTVLGEDDEAARTASAVALESAKGLLRSEVAKQLGMRHAPTLEFVHDALPESARQLDEVLARAKAQDEALAAGRGTAYAGEADPYKKPRPADADEPDDSGEPGEFDGVDDDE

rbfA

Ribosome-binding factor A

162 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.186 kDa

MPDPARARRLAKRINTIVASAIEFEIKDPGLDGVTIVDTKVTADLHDATVFYTVMGRTLDDEPDYGAAAAALERAKGALRTMVGAGTGVRFTPTLTFTRDTTSDSVARMDELLARARAADADLARVRSGAKPAGEADPYRESGSGVEPGRDGSIGDDDQPEY

rbfA

Ribosome-binding factor A

162 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.056 kDa

MVDPARARKLAKRIGTIVATAIDHEIKDPRLAFVTVTDTKVTADLHDATVYYTVMGADLESEPDLAAAAAGLEKAKGVLRSKVGAGTGVRFTPTLTFVADTVPDTARHMEELLARARAADDEVARVAAGASPAGDPDPYKEPRAEDADDAEVDEPSGSRQAD

rbfA

Ribosome-binding factor A

162 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.241 kDa

MVDPARARKLAKRIGTIVATAIDHEIKDPRLAFVTITDTKVTADLHDATVYYTVMGADLESEPDLVSAAAGLEKAKGVLRSKVGAGTGVRFTPTLTFVADTVPDTARHMEELLARARAADDEVARVAAGASPAGDPDPYKEPRVEDADDAEVDEPSRSRQAD

rbfA

Ribosome-binding factor A

160 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.39 kDa

MADNARAKRLADLIREVVAQKLQRGIKDPRLGSHVTITDTRVTGDLREATVFYTVYGDDEERKAATAGLESAKGILRSEVGKAAGVKFTPTLTFVMDALPDTARNIEDLLDKARQSDEKVREASAGATYAGEADPYRKPDEDETDTEGAVEADETDDTAK

rbfA

Ribosome-binding factor A

159 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.881 kDa

MSGNSRATRLGDRIKEIVATMLERRIKDPRLGFVTVTDVELTGDLQHATVFYTVLGDAEELASSTAALESAKGLLRSEVGKQTGVKHTPTLTFQLDATPQNAAHVEEALREAAARDAEVAALAATATYAGEADPYRRPAVDDAGDSADDADPAEDERPS

rbfA

Ribosome-binding factor A

159 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.001 kDa

MVDPARARKLAKRIGTIVATAIDHEIKDPRLAFVTITDTKVTNDLHDATVYYTVMGEKVDSAPDVEAAAAGLEKAKGVLRSKVGAGTGVRFTPTLTFVADTVPDTARHMEELLARAKAADDEVAKARENAQPAGDADPYKEPRVASDEDEASPDVREAD

rbfA

Ribosome-binding factor A

158 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.203 kDa

MTDNARARKLADRIQVVVAETLDRRIKDPRLGFVTITDARVTGDLREATVFYTVYGDDEERAASAAALESAKGVLRSEVGRQTGVRFTPTLAFVPDALPDNARTIEDLLDKARAKDAEVRQVSTGAQYAGDADPYRKPEDEDEETDGSSEKNEGPASA

rbfA

Ribosome-binding factor A

158 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.647 kDa

MAGTNPRAARIAALIQRVVASSIERELHDKRLASITVTEVRVTNDLQIAKVYWTQLGHEGHEEGERKRAQQALDQAKGHLRSLVGHKAGLRLTPQLQFVFDEVPGEAHEIEDILAVAKKRDEELARVRATAQYAGDADPYKHDDEAEAEGDEFESDEE

rbfA

Ribosome-binding factor A

158 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.052 kDa

MADPARARRLAKRIGAIVASAIEYEIKDPRLTMVTVTDTRVTNDLHDATVYYTVMGQTLSDEPDFAGAAAALDKAKGVLRTKVGAGTGVRFTPTLTFVLDTMADSARHMEELLDRTRAADAALAEVRQGAVHAGDADPYKESAAEEPAAYEDDERRPD

rbfA

Ribosome-binding factor A

157 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.544 kDa

MADNARAKRLADLIREVVAQKLQRGIKDPRLGSQVTITDTRVTGDLREATVFYTVYGDDEERAAAAAGLESAKGVLRSAVGAAAGVKFTPTLTFVADALPDTAKTIEDLLDKARASDAKVREVSAGAQFAGDADPYRKPESDDESDTAAKTDGDAAE

rbfA

Ribosome-binding factor A

157 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.561 kDa

MAGTNPRAARIAALIQRVVASSIERELHDKRLASITVTEVRVTNDLQIAKVYWTQLGHEGHEEGERKRAQQALDQAKGHLRSLVGHKAGLRLTPQLQFVFDEVPGEAHEIEDILAVAKKRDEELARARATAQYAGDADPYKHDDEPSDDFEDDSDEE

rbfA

Ribosome-binding factor A

157 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.561 kDa

MAGTNPRAARIAALIQRVVASSIERELHDKRLASITVTEVRVTNDLQIAKVYWTQLGHEGHEEGERKRAQQALDQAKGHLRSLVGHKAGLRLTPQLQFVFDEVPGEAHEIEDILAVAKKRDEELARARATAQYAGDADPYKHDDEPSDDFEDDSDEE

rbfA

Ribosome-binding factor A

157 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.851 kDa

MVRNIMAKEFSRTRRIAQQLQQELAQVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKAVVQEKLNALISAAPYIRTLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSQVINQDKAKQQQFGSEDASVEDEVLGDDVADDADETEGKD

rbfA

Ribosome-binding factor A

157 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.851 kDa

MVRNIMAKEFSRTRRIAQQLQQELAQVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKAVVQEKLNALISAAPYIRTLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSQVINQDKAKQQQFGSEDASVEDEVLGDDVADDADETEGKD

rbfA

Ribosome-binding factor A

157 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.865 kDa

MVRNIMAKEFSRTRRIAQQLQQELAQVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKAVVQEKLNALISAAPYIRTLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSQVINQDKAKQQQFGSEEASVEDEVLGDDVADDADETEGKD

rbfA

Ribosome-binding factor A

156 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.594 kDa

MADPARAKRLAKRISTIVASAIEYEIKDPRLAGVTITDAKVSGDLHDATLYYTVLGASLDEDPDYEGAAAALEKAKGVLRTKVGAGTGVRFTPTLAFVRDTVPDAAHRMEELLARARAADEDLARVREGAKHAGDPDPYRVGGAEDTDGDTDGDER

rbfA

Ribosome-binding factor A

156 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.036 kDa

MSDPAKVRRHAERVRELVASVVRSQIKDPRLGMITITDARITADLRDATVFYTVLGDTAAQSGTAAALESAKGMLRSTVGKALGLRHSPTLTFVLDDVQDQVKHIDDLLAQARHADAEVQRLAARAEYAGEAQPYRVEEEPGDSEDETPPSSQDQR

rbfA

Ribosome-binding factor A

156 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.915 kDa

MSDPAKVRRHAERVRELVASVVRSQIKDPRLGMITITDARITADLRDATVFYTVLGDASAQASTAAALESAKGMVRSTVGKALGLRHSPTLTFVLDDVQDQVKHIDDLLAQARHADAEVQRLATRAEYAGEAQPYRLEEEPEGSGDEVPPPGGDQR

rbfA

Ribosome-binding factor A

155 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.246 kDa

MADRARAARMAKRIQTIVANTIEHSVKDRRLELVTITDTQLTGDLHDATVFYTVRGRTLDEEPDREQAAEALHRARGQLRKAVGDQLGVRFTPTLTFTLDTVPETSARLEELLAQARQRDQEVARQAEGATPAGDANPYKTSPHEGRPESEADGW

rbfA

Ribosome-binding factor A

155 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.894 kDa

MSRLHHQQGGQPSQRMLRVAELVRHAMSELLTRSDINDPALEGKVITVPDVRMSPDLKLATVYVMPLGGENVTEVLAALDRHKKLLRGEIARRVSLRFAPDVRFKADPGFEYSGKIDALLSSPKVKQDLEVQDLELKDSGCAGAPAKTGPAGDGE

rbfA

Ribosome-binding factor A

153 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.669 kDa

MADAARAARLADRIKVIVAQALERRVKDPRLGFVTVTDARVTNDLQHATLYYTVYGDEEQRADTARALESAKGVLRAEVGKNITARLTPTLTFVADEIPADAARLEELLRTAREKDAQVAEQAQGAQYAAGEDAYRTPSDEDDAEGPESAPRV

rbfA

Ribosome-binding factor A

151 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.604 kDa

MKPDTRTGGGPSQRMLRVGELVRHALADVLQRGSVTDPVLAAHIITVPEVRMSPDLKIATCYVMPLGGKDITPVIKALAANARYLRLEVGRRMELKSVPELRFREDTSFDEGARMDALLRSPKVVRDLDDTSSDDTSPDANTDTDKETDAE

rbfA

Ribosome-binding factor A

151 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.615 kDa

MVDAARASKLADRIQRIVAEMLERRIKDPRLGFVTVTDARLTNDLRDATVYYTVFGSDAEKAATAAALESAKGLIRSEVGRRTGLRHTPTITFVIDEVPDNARHIEELLAKAKQADAEVARAAANARPAGDPDPYREPRPADDDDEDDEDE

rbfA

Ribosome-binding factor A

150 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.573 kDa

MARSHDTKGSGGLSQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADPQAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDLSHDDDEDGGADEAPRNGDE

rbfA

Ribosome-binding factor A

150 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.603 kDa

MARSHDTKGSGGLSQRQLRVGEQVRHTLAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADPQAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDLSHDDDEDGGADEAPRNGDE

rbfA

Ribosome-binding factor A

150 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.573 kDa

MARSHDTKGSGGLSQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADPQAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDLSHDDDEDGGADEAPRNGDE

rbfA

Ribosome-binding factor A

150 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.61 kDa

MARSPDPKGSGGLSQRQLRVGEQVRHALAQVLQRGEIRDDLIAHTVISVSEVRMSPDLKIATCFITPLGNADTQAVIKALAANAKFIRGRMAPSLSQMKYMPEFRFRADTSFDNFSKIDALLRSPEVARDLGHDDEEDREADKASRNGDE

rbfA

Ribosome-binding factor A

150 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.432 kDa

MNDRARARKLADRIKVVVAETLERRVKDPRLGFVTITDARVTPDLREATVFYTVLGDDTALAETAAALESAKGVLRAEVGRQTQVRFTPTLTFVPDTVPRQARQIEELLARARAADREVAERAKSAQPAGEPDPYRFDGAAAADDDEPAT

rbfA

Ribosome-binding factor A

150 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.573 kDa

MARSHDTKGSGGLSQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADPQAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDLSHDDDEDGGADEAPRNGDE

rbfA

Ribosome-binding factor A

150 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.573 kDa

MARSHDTKGSGGLSQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADPQAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDLSHDDDEDGGADEAPRNGDE

rbfA

Ribosome-binding factor A

150 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.573 kDa

MARSHDTKGSGGLSQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADPQAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDLSHDDDEDGGADEAPRNGDE

rbfA

Ribosome-binding factor A

150 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.573 kDa

MARSHDTKGSGGLSQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADPQAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDLSHDDDEDGGADEAPRNGDE

rbfA

Ribosome-binding factor A

150 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.633 kDa

MARSHDTKGSGGLSQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADPQAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRFPEVARDLSHDDDEDGGADEAPRNGDE

rbfA

Ribosome-binding factor A

150 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.633 kDa

MARSHDTKGSGGLSQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADPQAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRFPEVARDLSHDDDEDGGADEAPRNGDE

rbfA

Ribosome-binding factor A

149 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.794 kDa

MKRQSDPKKGALTGPSQRQLRAGELIRHALVEILREEELQDEALQNISVTVSEVRMSPDLKHAICFVEPLGAGLTGQDTTDIIKGLNRVSKFLRGRLGRSIDMKFTPDLKFIHDESFGTAAYMDKLFLDPRVQQDTRRLSDVVDDEDEA

rbfA

Ribosome-binding factor A

149 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.794 kDa

MKRQSDPKKGALTGPSQRQLRAGELIRHALVEILREEELQDEALQNISVTVSEVRMSPDLKHAICFVEPLGAGLTGQDTTDIIKGLNRVSKFLRGRLGRSIDMKFTPDLKFIHDESFGTAAYMDKLFLDPRVQQDTRRLSDVVDDEDEA

rbfA

Ribosome-binding factor A

149 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.938 kDa

MAKEFSRTRRIAQQLQQELAQVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKAVVQEKLNALISAAPYIRTLVAGRMKLRVMPELRFVYDSSLVEGMRMSNLVSQVINQDKAKQQQFGSADEVLNEDEGATDDTDDTKGKD

rbfA

Ribosome-binding factor A

149 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.938 kDa

MAKEFSRTRRIAQQLQQELAQVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKAVVQEKLNALISAAPYIRTLVAGRMKLRVMPELRFVYDSSLVEGMRMSNLVSQVINQDKAKQQQFGSADEVLNEDEGATDDTDDTKGKD

rbfA

Ribosome-binding factor A

149 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.662 kDa

MVDNARAARMAKRIQTIVASAIEREIKDRRLEYITITDVTMTGDLHDATVFYTVRGENVGDEPDLEAAAEALHRARGQLRKIVGEQLGVRFTPTLTYRVDTVPEASAHMEALLERARQRDAELAKLKENAVPAGDPNPYKSDTREEDEA

rbfA

Ribosome-binding factor A

149 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.498 kDa

MADNARAARMAKRIQTIVASAIERDIKDRRLEFVTITDVTMTGDLHDAKVFYTVRGASIEEEPDLEAAAEALHRARGQLRKIVGQQLGVRFTPTLTYSIDTVPEASAHMEALLDRARKRDEELAKLREGAVPAGDADPYKTSSKSESEE

rbfA

Ribosome-binding factor A

149 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.47 kDa

MADNARAARMAKRIQTIVASAIERDIKDRRLEFVTITDVTMTGDLHDAKVFYTVRGASIEEEPDLEAAAEALHRARGQLRKIVGQQLGVRFTPTLTYSIDTVPEASAHMEALLDRARKRDEELAKLREGAAPAGDADPYKTSSKSESEE

rbfA

Ribosome-binding factor A

149 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.439 kDa

MATARRVARVAELIKREVSQILLSEIKDDRVGAGMVSIVDVEVSNDLQNARIFVSIYGDEAAQQQTMEGLASATPFVRREIGQRLGLRRVPTVVFLQDRSLERGSRVLALLNQLRQPAEAQQQEGSHPGVEGRMADTPGGEEDELSEQQ

rbfA

Ribosome-binding factor A

149 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.078 kDa

MNPIRMKKLESEIIRQISTAILEGKVKDPRVFLPSFHRIEISEDLKYAKVYFTALCNNNERKKLTQGLVSCAGFLSSFVGKNLRLHTNPKFTFVWDNSYIKSLEVNRLIDDSAPKTLFEELHPNPEEDDGDTDAETLLEDSESGIERET

rbfA

Ribosome-binding factor A

149 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

17.078 kDa

MNPIRMKKLESEIIRQISTAILEGKVKDPRVFLPSFHRIEISEDLKYAKVYFTALCNNNERKKLTQGLVSCAGFLSSFVGKNLRLHTNPKFTFVWDNSYIKSLEVNRLIDDSAPKTLFEELHPNPEEDDGDTDAETLLEDSESGIERET

rbfA

Ribosome-binding factor A

148 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.038 kDa

MADPARAGRLAQRIKVLVAEALRRGVKDDRVEPVTVTEVRVTNDLQHATVYYTVLGDEATVAAAHEGIQDNRGILRREVGRGLTIRLVPTLEFVADTVPEAAAHLEDVLRAAKERDAELAKAREGASYAGDADPYRTAEPDADDAPRA

rbfA

Ribosome-binding factor A

147 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.765 kDa

MAKEFSRTRRIGQQLQQELAVVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKDVVQEKLNALIAAAPYIRTLVAGRMKLRVMPEIRFVYDSSLVEGMRMSNLVSQVINSDKAKQQQFGSVDDDVIENDIEESDDTEGKV

rbfA

Ribosome-binding factor A

147 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.909 kDa

MVDQARARRLAKRISEIVATAIEYEVKDPRLRFVTITDAKVTGDLREATVYYTVMGETIDAEPDYDAAAAGLAKAKGVLRSKVGAGTGVKFTPSLAFVLDKVPDAAREMEELLARARAADAEVARVAAEARHAGEPDPYKTDRDDAE

rbfA

Ribosome-binding factor A

147 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.252 kDa

MVDHARAARMAKRIQTIVASAIERQIKDRRLELVTITDARVTGDLHDATVFYTVRGTDIGTEPDYDQAAEALTRAKGQLRKIVGDELSVRFTPTLSFELDTVPEASAHMEELLARARARDAELAKLKEGAQPAGDANPYKTSDEEED

rbfA

Ribosome-binding factor A

147 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.499 kDa

MVDHARAARLAKRIQTIVATAIEREVKDRRLEYVTVTDTRVTGDLHDATVYYTVRGRTIDDQPDLKAAAEALQRARGQLRKIVGDQLSVRFTPTLSFELDTVPETSAHMEDLLARARARDLELAELKKNAQPAGDAHPYKDDDAMND

rbfA

Ribosome-binding factor A

146 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.596 kDa

MAKEFSRTRRIAQQLQQELAVVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKELVQEKLNALITAAPYIRTLVAGRMKLRVMPEIRFVYDSSLVEGMRMSNLVSQVINSDKAKQQQFGSAEDVTSNDIDEADDTEGKA

rbfA

Ribosome-binding factor A

146 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.566 kDa

MAKEFSRTRRIGQQLQQELAVVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKEVVQEKLNALIAAAPYIRTLVAGRMKLRVMPEIRFVYDSSLVEGMRMSNLVSQVINSDKAKQQQFGSADDVTENDIDEADDTEGKA

rbfA

Ribosome-binding factor A

146 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.594 kDa

MAKEFSRTRRIGQQLQQELAVVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDKEVVQEKLNALIAAAPYIRTLVAGRMKLRVMPEIRFVYDSSLVEGMRMSNLVSQVINSDKAKQQQFGSVDDVTENDIDEADDTEGKA

rbfA

Ribosome-binding factor A

146 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.977 kDa

MGEVRRPDRVAEAIREEVATFLSEGAKDPRIRAFVTVTAVEVTRDLRHATVFVSLMGDDADKKSTTAGLASVASHLRSQLGKSLRLRSAPEIHFRTDESVARASRIEHLLAKIRDEREAQEPAQDPAQDSSQDASVEASDAPDKAE

rbfA

Ribosome-binding factor A

146 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.172 kDa

MADPARAARLAQRIKVIVAEALRKQVKQPGVENITITETRVTNDLQHATIYYTIFGGTEARQEAEDSLAKSKGILRREVGKNLTIRLTPTLEFISDEVPETASHVEELIRLAKERDAELAARAARAEFAGEADPYKKPEDDEAAES

rbfA

Ribosome-binding factor A

146 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.417 kDa

MPRPTTSSPSQRMLRVAEQVRHALSETLQRGEIIDPLIENTVVSVSEVRMSPDLRVATAFVSPLGAKDTDAVVEALNKHAKFVRGRVSGALRQMKFMPEFRFKLDTSFDNFARINDLLKSPEVARDLDADDDKTKDDRAKDDKDSE

rbfA

Ribosome-binding factor A

145 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.485 kDa

MKRPSSHGRRPPQGPSQRQLRAGELVRHALVEIFREEEINDPVLAGVSVTVTEVRVSPDLRHATVFVEPLGGEHADEVVQALNRHARFLRGHLGRAIELRFTPELKFLHDESFNEAARMAKLFDDPKVRQDLTPQPPSDSWKDED

rbfA

Ribosome-binding factor A

145 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.356 kDa

MAQKQTPSGPTQRQQRVAELIRHALAEVLQRGDIQDPVLGSHVVTVPEVRMSPDLKLATAYVMPLGGQDEAPVIAALERHKKILRQEVARRVNLKFAPDLRFRRDETFDEAARIDQLLRSEKVQRDLESAPREDDEGEPASSSRD

rbfA

Ribosome-binding factor A

145 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.401 kDa

MAQKQTPSGPTQRQQRVAELIRHALAEVLQRGDIQDPVLGSHVVTVPEVRMSPDLKLATAYVMPLGGQDEAPVIAALERHKKILRQEVARRVNLKFAPDLRFRRDETFDEAARIDQLLRSEKVQRDLESAPREDDEGEPDSSSRD

rbfA

Ribosome-binding factor A

145 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.401 kDa

MAQKQTPSGPSQRQQRVAELVRHALAEVLQRGDIQDPVLGSHVVTVPEVRMSPDLKLATAYVMPLGGQDEAPVIAALERHKKILRQEVARRVNLKYAPELRFRRDETFDEAARIDQLLRSEKVQRDLESAPREDDEAEPDSASRD

rbfA

Ribosome-binding factor A

145 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.935 kDa

MKTQDRSGSGPSQRMLRVGELVRHALADALQRGDHLDPALAGTIITVPEVRMSPDLKIATCFVMPLGGKDVNTVIKLLAANQKLLRTEVARRVELKSVPSLRFLRDTSFDEGARIDALLRRPDVARDLDTETDAEAGSETTKEED

rbfA

Ribosome-binding factor A

144 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.553 kDa

MAREFSRTRRVGQQIQREIALILQREVKDPRIGMVTVSDVEVSRDLNYAKVYVTFLQLENDAERIKEGLKALTEAAGYIRSLLGSAMRLRVVPELRFFYDQTLVEGMRLSNLVTNTIREDKRRMAESGREEDDAAPDETTEDNA

rbfA

Ribosome-binding factor A

144 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.369 kDa

MAREFSRTNRVGQQIQREIALILQREVKDPRIGMVTVSDVEVSKDLNYAKVYVTFLQLDIDAERIAEGLKGLTEAAGYIRSLLGSAMRLRVVPELRFYYDQTLVEGMRISNLVSNTVRDDKRRMAEAGREEDEAAPDDTTEDKA

rbfA

Ribosome-binding factor A

144 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.857 kDa

MATARRVARVAELIKREVSQILLSEIKDDRVGAGMVSIVDVEVSNDLQNARIFVSIYGDETAQHQAMEGLAAATPFVRREIGQRLSLRRVPTVVFLQDRSLERGSRVLALLNQLRPTFEAKAQTGVEEPLENTAEGEENPSGGE

rbfA

Ribosome-binding factor A

144 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.374 kDa

MPRHHQKKSSASGGGSQRQLRVGEQVRHAMAEILAQGNVHDADLEGHIVTVPEVRMSPDLKLATIYVMPLGGRDTEIVIAALERNKKFLRGEVARRVNLKFAPDVRFRVDERFDEAERIEKLLRTPAVQKDLEQDPDSDREEEQ

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.355 kDa

MAAEGRVQRVASELQKVISLLLRTKIKDSKLATATITEVELSKDLSYAKVYYTCLDIQEAQYISKAFEKSKGFFRSSIAKSLNLRIVPNLKFVYDKSLDYGMEMEGKIQQALEADSKIIKQDDNSLQENYKDSDKETKVEKLR

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.408 kDa

MAREFSRTRRIAQQLQQELAQVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVYVTFFEEDEKLVQEKVEALDAAAGYIRSLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSRVISDDEAKQKQHGDQQDVSQSSDDKSEGED

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.867 kDa

MARSKNQNGPSKSQRQLRVGELIRRTLSTVLARADVHDPALNAMSITVAEVRTSSDLKIATVYVMPLGGSGKDEAIEALKRNKGELRRLLGKDLKLKYLPDLRFVIDQTFDQMDATREMLARADVRRDVEKAEDDGPMDGDGA

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.956 kDa

MRFMGKNKFHTGPGPSQRQLRVGETIRRALSDVLARGDVHDTDLNRLSVTVGEVRASPDLKIATAYVLPLGGQGKDEVIALLARNKGELRRLVAKKLTLKFAPDLRFQLDETFDRMDETREMLNRAEVKRDTGPVPAGESDTE

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.416 kDa

MAAEGRVQRVASEFQKVISLLLRTRIKDAKLASATITEVDLSKDLSYAKIYYTCLAIEDAEYIDKAFEKSKGFFRSSIAKSLSLRIVPNLKFIYDTSLDYGMQMEEKIQQALEADSKIIKQDDKSLQENYKQNDKETKAEKLR

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.416 kDa

MAAEGRVQRVASEFQKVISLLLRTRIKDAKLASATITEVDLSKDLSYAKIYYTCLAIEDAEYIDKAFEKSKGFFRSSIAKSLSLRIVPNLKFIYDTSLDYGMQMEEKIQQALEADSKIIKQDDKSLQENYKQNDKETKAEKLR

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.416 kDa

MAAEGRVQRVASEFQKVISLLLRTRIKDAKLASATITEVDLSKDLSYAKIYYTCLAIEDAEYIDKAFEKSKGFFRSSIAKSLSLRIVPNLKFIYDTSLDYGMQMEEKIQQALEADSKIIKQDDKSLQENYKQNDKETKAEKLR

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.416 kDa

MAAEGRVQRVASEFQKVISLLLRTRIKDAKLASATITEVDLSKDLSYAKIYYTCLAIEDAEYIDKAFEKSKGFFRSSIAKSLSLRIVPNLKFIYDTSLDYGMQMEEKIQQALEADSKIIKQDDKSLQENYKQNDKETKAEKLR

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.382 kDa

MAAEGRVQRVASELQKVISLLLRTRIKDAKLASATITEVDLSKDLSYAKIYYTCLAIEDAEYIDKAFEKSKGFFRSSIAKSLSLRIVPNLKFIYDTSLDYGMQMEEKIQQALEADSKIIKQDDKSLQENYKQNDKETKAEKLR

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.416 kDa

MAAEGRVQRVASEFQKVISLLLRTRIKDAKLASATITEVDLSKDLSYAKIYYTCLAIEDAEYIDKAFEKSKGFFRSSIAKSLSLRIVPNLKFIYDTSLDYGMQMEEKIQQALEADSKIIKQDDKSLQENYKQNDKETKAEKLR

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.416 kDa

MAAEGRVQRVASEFQKVISLLLRTRIKDAKLASATITEVDLSKDLSYAKIYYTCLAIEDAEYIDKAFEKSKGFFRSSIAKSLSLRIVPNLKFIYDTSLDYGMQMEEKIQQALEADSKIIKQDDKSLQENYKQNDKETKAEKLR

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.416 kDa

MAAEGRVQRVASEFQKVISLLLRTRIKDAKLASATITEVDLSKDLSYAKIYYTCLAIEDAEYIDKAFEKSKGFFRSSIAKSLSLRIVPNLKFIYDTSLDYGMQMEEKIQQALEADSKIIKQDDKSLQENYKQNDKETKAEKLR

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.642 kDa

MADNARAARMAKRIQQIVAVAIEREIKDPRLEYVTITDTRMTGDLHDASVFYTVRGASIDEEPDVPLAAAALESAKGQLRKIVGDQLSVRFTPTLSFVHDTVPEASAHMEKLLAEARAKDEAVRAQAAQAKPAGEANPYKERN

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.277 kDa

MAREYSRVDRIGDQMQRELAQLIQREVKDPRVGMVTVNDVKVSRDLGYADIYISLLSTEELTEDSPEVQDSLTVLNKASGFLRGQVGRAMKLRVVPHLRFHFDKLLGQSRKMDRLIREAVGDKPAVPRDDNDDPVSDNPERDA

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.482 kDa

MAKEFSRTRRIAQQLQQELAMVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVYVTFFEEDTELVQQKIDALTVAAPYVRTLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVTQVINKDKAKQQQFTPDTPDNSESVDGEKEQD

rbfA

Ribosome-binding factor A

143 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.602 kDa

MNTPNPRVAKLADQIRVVVAETLERRVKDPRLGFVTITDVRLTGDSRDATLFWTAMGTDKEIAGTEAALESAKGMLRSTVGKRLKLRYAPTLTFVRDATPETAKSIEDALARAAASDAEIARRSQGAMPAGEADPYRHSDEEE

rbfA

Ribosome-binding factor A

142 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.046 kDa

MAPGRRVERVAALIRRETSELLIHGIRDERVHQGMVSITNVEVSGDLQHCKIFVSIYGEEIQRSEVLEGLEAASGFLRGELGRRLQMRRAPEVHFHLDRGIEKGTSVLNLLEQLEQQRETLGEVQSESDQPTTDETTTVNKT

rbfA

Ribosome-binding factor A

142 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.203 kDa

MAKEFSRTRRIAQQLQQELAQVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVYVTFFEEDEKLVEQKVAALDAAAGYIRSLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSRVISNDEAKQKQHGVETDAEQGETKDEGDK

rbfA

Ribosome-binding factor A

142 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.203 kDa

MAKEFSRTRRIAQQLQQELAQVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVYVTFFEEDEKLVEQKVAALDAAAGYIRSLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSRVISNDEAKQKQHGVETDAEQGDTKEEGDK

rbfA

Ribosome-binding factor A

142 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.23 kDa

MAKEFSRTRRIAQQLQQELAVVLQRDMKDPRIGFVTVNDVDVSRDLSYAKVFVTFFEEDEKLVQEKVEALDAAAGYIRSLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSRVISDDEAKQQEHGTVENAKQDGDKAEDDK

rbfA

Ribosome-binding factor A

142 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.976 kDa

MAREYARTDRVGQQIQKEIATILMREIKDPRLSMTTVSAVEVTRDLAYAKIFVTFFNDNQDEIKASLEVLAEAEGYIRSLLGKRLRARIMPHLRFVYDSSMSEGVRMSALVDQAVASDKNGDAEVDDTQVDDEPSVDSEKGE

rbfA

Ribosome-binding factor A

142 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.977 kDa

MAQKPTSTGPSQRQQRVAELVRHALAEVLQRGDIQDPVLGTHVVTVPEVRMSPDLKLATAYVMPLGGLDEAPVIAALERHRKVLRQAVARRVNLKFAPELRFRRDETFDEAARIDRLLRDERVQRDLDSAPEDDEPETGTGH

rbfA

Ribosome-binding factor A

142 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.233 kDa

MAKEFSRTRRIAQQLQQELAVILQRDMKDPRIGFVTVNDVDVSRDLSYAKVFVTFYEEDLTLVEQKIAALTAAAPYVRTLVAGRMKLRVMPELRFIYDSSLVEGMRMSNLVSQVITNDKAKQKQAGREDDTPSVDEQEKDTD

rbfA

Ribosome-binding factor A

142 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.02 kDa

MSSRSRHDVKGPAGVSAHGPSTRQLRVAEEVRRVLAELFARTEFRDPELLDVRITVTEVRISPDFRHATAFVTRLGRSDVEVLLPALKRVAPFLRTGLSKALNLRTVPEIHFQPDTALDNAMELDEIMRSPEVQRDLNSKPE

rbfA

Ribosome-binding factor A

142 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.094 kDa

MAPGRRVERVAALIRRETSELLIHGIRDERVHQGMVSITNVEVSGDLQHCKIFVSIYGEEIQRSEVLEGLEAASGFLRGELGRRLQMRRAPEVHFHLDRGIEKGTSVLNLLEQLEQQRETLGEVQSESDQPTTYETTTVNKT

rbfA

Ribosome-binding factor A

142 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.5 kDa

MADPARARKLADRIKVIVAERLDRGLRDPRLGFVTITDVQVTGDLQHATVFYTVYGTDQERADTAAALTAATGMLRSEVGKNITARLTPTLQFQLDAIPENAAHIEDLLRQARDHDTEVAGLAEGAAYAGEQDPYVKPREAN

rbfA

Ribosome-binding factor A

142 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.784 kDa

MSRGAKPPSQRQLRVGEELRHAIAMVIERGEFRDPDLLGRAITVTEVRVSPDLRNATVFVVPLGGGDVAPILAGLKRAKAFLRHEISRMVELRAVPDLWFQEDTTFDTASRIDSILNSPEVRRDIDHAPAEDEFPTDGDDGQ

rbfA

Ribosome-binding factor A

141 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.855 kDa

MRRNQTPEGHSIRPLRVGEQIRHVLAEMLMRGEIHGDTLDNLFVSISEVRMTPDLRIATVFVKSLGGASDDTVIGILSKNASFLQAAIAKKIRLKYVPKLRFLADESFEQGSRIDSLLRSPHVQRDLQENDDQEDDSEGSL

rbfA

Ribosome-binding factor A

141 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.571 kDa

MPRHSRGKSSSSASGASQRQLRVGELIRHAMADILAQGGVHDDTLAGHIITVPEVRMSPDLKLATVYVMPLGGHDTEAVLAALAHNKKFLRGEVAHRVNLKFAPELRFRVDERFDEAERIEKLLRTPAVQRDLNSDSDDNA

rbfA

Ribosome-binding factor A

141 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.815 kDa

MSRAHHQQGGAPSQRMLRVAELIRHTLSDLLSRSIVNDPVLEGHVITVPDVRMSPDLKLATAFVMPLGGKDINSVIEALDRHKKFLRSEIAQRIHLRFAPDIRFKADESFDYGDKIDALLASPQVRRDLDATHTETQKAAD

rbfA

Ribosome-binding factor A

141 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.316 kDa

MVDHARAARMAKRIQQIVATAIERQIKDPRLEFVTITDARVTGDLHDATVFYTVRGKTVDAEPDTATAEAALAKATGQLRKIVGDQLSVRFTPTLSFSLDTVPEASAHFEELLARAKAQDEALRAQSAGARPAGDEDPYKP

rbfA

Ribosome-binding factor A

141 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.644 kDa

MARRQTHTSKGPSQRQLRAGELVRHALVGIIAREEFRDPDLEGQMISVTEVRPSPDLRVAKVYVAPLGRGDSAKLAAGLNRCAAFLRGRLGREIEMKFTPELHFHADNSFDTASHVDDLLNRPTVRKDLDATRGSEADAED

rbfA

Ribosome-binding factor A

140 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.037 kDa

MAREFSRTRRIAQQLQQELAQVLQRDIKDPRIGMVTVNDVDVSRDLNYAKVYVTFFEEDKAVVEEKLAALEAAAGYVRSLVAGRMKLRVMPEIRFIYDASLIEGMRMSNLVSQVITKDKAKAAEHGREDEELDDTEQDDK

rbfA

Ribosome-binding factor A

140 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.081 kDa

MAREFSRTRRIAQQLQQELAQVLQRDIKDPRIGMVTVNDVEVSRDLSYAKVFVTFFEEDSKLVEEKLEALTTASGYVRSLVAGRMKLRVMPELRFVYDASLVEGMRMSNLVTRIIHDDEAKQQKHNGKDKTDTADSEGEE

rbfA

Ribosome-binding factor A

140 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.963 kDa

MSVWDPKEILDSIGLGKRTEVKRSTRVADAIRKELAVLLLEKIRDPKLQDVGISRVTATDDLTIVKIYYTIYGPHKHVKAVDKAFLAATGFIRSHLARTLNMRYTPNLQFCYDKTAEKVAEIENIFQEIAKERQDNGENS

rbfA

Ribosome-binding factor A

140 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.596 kDa

MQKKSSSKSHRATRGPSQRQLRAGELIRRALSDVVTRGTIQDPDLIERSFSVTEVRVSPDLRHATCFVAPLGKGDAAALAAALTRVRGYLRGQLSKEVTFKYMPDLTFEPDTSFDKAEQIDRLLHSPKVSQDLSPQDDEE

rbfA

Ribosome-binding factor A

140 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.089 kDa

MLRDRNRSGVRGGAEGPSQRQRRVAEDLRHRLAELFARTEFRDPELAGVHITVAEVRMSPDLKHATVFVSRLGATDIDRYLPALKRIAPFLRGEIGHGLRMKFVPDLHFQPDHALDEATRINELLHRPEVMRDLLKPDEE

rbfA

Ribosome-binding factor A

140 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.93 kDa

MNQRLQRLGDQIQRELAVLIRDDVNDPRLTGFVTISSVKVSSDLGYADVYVTIMEPELNDAMSKHSHEESLKVLNKAAGFLRTELSHSLKTRTTPRLRFHYDEVTARGNYMMDLINKAVTKTEQTSADDDADRLDSEDRS

rbfA

Ribosome-binding factor A

140 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.629 kDa

MAQGRRVERVAALIRKEVSELMINGIRDERVHHGMVSITEVEVSGDLQHCKIFVSVFGEAQERDQVLEGLQAASGFLRGELGRRLQMRRAPEVVFQLDRGLERGTSVLGLLNRLEDERQQRGDIPPGSDQQPGSDEQPTG

rbfA

Ribosome-binding factor A

140 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.502 kDa

MAPGRRVERVAALIRKETSELLMHGIRDDRVHQGLISITQVDVSGDLQHCKIFVSVLADPEGRAQVMEGLQAASSFLRGELGRRLQMRRAPEVVFHLDRGLEKGASVLGLLGDLERERQERGEIPPGSDDAQNCHDDEPS

rbfA

Ribosome-binding factor A

140 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.888 kDa

MGPMAHRSHTGTGPSQRQLRVGELIRRTLADVLNRGEIHDPELNRLSITVGEVRCSPDLKVATVHVMPLGGKDVEEAISLLSKHRGELRHHITRQMTLKYAPDLRFRPDETFDRLDETRRLFSDKTVMRDIRGGGEADED

rbfA

Ribosome-binding factor A

140 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.935 kDa

MGRMAHRSHTGTGPSQRQLRVGELIRRTLADVLNRGEIHDPDLNRMSITVGEVRCSPDLKVATVHVMPLGGKDVEEAIALLSKHRGELRHHITRQMTLKYAPDLRFRPDETFDRLDETRRLFSDETVQRDIRGSGDGDED

rbfA

Ribosome-binding factor A

139 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.49 kDa

MATNRRVSRVAELIKREVSQMLLNGIKDDRVGTGMVSVTDVDVSGDLQHAKIYVSIYGTDEAKVETMAGLKSATGYVRSELGARVRLRRTPEVIFLEDRSIERGNKVLALLSQLNHDRPPENLLAVEDNTDEDDESFSE

rbfA

Ribosome-binding factor A

139 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.373 kDa

MTTHNRPARVAEEFRHELSAILARGLKDPRITGFVTVTGSKMSPDLKEATVYVSIHGDERVRKDTFAGLQAAAGFLQREVSRALRLRNTPHLRFVYDESVARGDRIERLLREARTQGQAAPAPDVEPAPGAAPDDEAEE

rbfA

Ribosome-binding factor A

139 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.719 kDa

MRKPTETAGPSQRQQRVAELVRHAIAEVLSRGDLQDPVLSRHVITVPEVRMSPDLKLATAYVMPLGGQDEAPVLEALERNRKALRQEVARRVNLKFAPELRFRRDETFDEAARIDRLLRSEKVQRDLGGEQDDAGDPDA

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.602 kDa

MAKEYSRTQRVAQEMQKEIAIILQREIKDPRVGMATVSGVEVSRDLAYAKVFVTFLNDNTLEQVKTGVRALQDAAGFIHSLLGKAMRLRVVPELTFAYDNSLVEGMRMSNLVSQVVQNDRLRRSASPVDKTDREDKED

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.678 kDa

MAQNRFHSGTGPSQRQLRVGELIRRTLSDVLLRGDVHDPELNRHSITVGEVRTSPDLKVATAYVLPLGGHDAEEALAALRRNAGELRHLVAKAMTLKYAPQLRFVLDETFDRMDDTRRLLSEDRVRRDVESHPEDDED

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.449 kDa

MAKEYSRTQRIGDQMQRELAQLIRREIKDPRVGLVTITAVDVSRDVGHAKIFMTVMGQDNAEDIAQTIKVLNAAAGFLRMQLAREMKLRSVPQLHFHYDESVVRGAHLSALIERAVAQDSQHQEGPASPDAKPESTEE

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.396 kDa

MAKEYSRTQRIGDQMQRELAQLIRREIKDPRVGLVTITAVDVSRDVGHAKIFMTVMGQDSAEEIAQTIKVLNSAAGFLRMQLAREMKLRSVPQLHFHYDESVVRGAHLSALIERAVAEDGQHQEGPASADAKPESTEE

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.599 kDa

MAKATSSAPSQRMLRVGEQVRAALTQILQRGEVRDDLIEGTVISISEVRMSPDLKIATAYVTPLGVADHTDIISALNRHAKFMRGRLGPQLRQMKYMPELRFRDDTSFDNYQKIDALLRSPEVQRDLGPSNEKDDEQN

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.098 kDa

MSALAYPRVNRLAEEIKKIISHMIRNDLRDPRIAKMTSIIEVNVTRDLRFATIYISVLGDQQEKEETIEGLKKSSGFIRKEVGRQITARFTPELIFKLDESIERGVYMYDVISKVTQKDMDEKKNSDEKRDSDEKLED

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.334 kDa

MTTHNRPARVAEEFRHELSALLARGLKDPRITGFVTVTGSKMSPDLKEATVYVSIHGDERVRKDTFAGLQAAAGFLQREVSRALRLRNTPHLRFVYDESVARGDRIERLLREARTQGQEPAADVEPAPGAAPDDEAEE

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.276 kDa

MTTHNRPARVAEEFRHELSAILARGLKDPRITGFVTVTGSKMSPDLKEATVYVSIHGDERVRKDTFAGLQAAAGFLQREVSRALRLRNTPHLRFVYDESVARGDRIERLLREARTQGQAPAADVEPAPGAAPDDEAEE

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.387 kDa

MAKAKKGFSRSDRVAEQIQRELAELTRKGLKDPRAGWITITAVEVTRDYSHAKVYYTVMVDSTREATQEALDSSAGYLRNELGRAIKMFSMPQLHFVYDDSVERGMHLTSLINQVAREDAEKFGEAAAGEAEGEGKAE

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.293 kDa

MATGRRVSRVAELIKREVSQMLLHSIKDDRVGSGMISVTAVDLSGDLQHAKIFVSIYGTDEARAETMAGLESATGYVRKQLGHRIHLRRTPEVIFCEDRSFEEGNQVLSLLHKLDHERQNKPAASTEKPPVGSLDADL

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.53 kDa

MSSRPPSSSGPAGIPKGAPSQRQLRVAEEIRHVLAGVFARQEFRDPELATTTFTINEVRISPDLKHATVFISRLGSSEIEPLLPNLKRVATYLRGEVAKVMRLRYAPELHFQPDSALEYAMHVDSLLRRPEVKRDLDE

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.411 kDa

MAKEYSRTQRIGDQMQRELAQLIRREIKDPRVGLVTITAVDVSRDVGHAKIFMTVMGQDSAEEIAQTIKVLNSAAGFLRMQLAREMKLRSVPQLHFHYDESVVRGAHLSALIERAVAQDGQHQEGSASPDAKPESTEE

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.003 kDa

MAREFSRTDRVGQQIHKEIASILQNEFKNRDPRLGMVTVSAVEVSRDLAYTKIYVTFFENDEEVMDNYLSILEENKGYIRTLLANRMRMRAVPAIKFVRDGSLSEGIRISNLVDETLNKDKERARNAGRSLDEDEQED

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.543 kDa

MPRHHQRGSTASGGSQRQLRVAETVRHAVADILSQGSAHDPDLEGHIITVPEVRMSPDLKLATIYIMPLGGRDTEIVLAALERNKKFLRGEIAHRVNLKFAPDIRFRADERFDEAERIEKLLRTPAVQRDLNSDSEES

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.544 kDa

MPRHHQRGSAASGGSQRQLRVAETVRHAVADILSQGSAHDPDLEGHIITVPEVRMSPDLKLATIYIMPLGGRDTDVVLAALERNKKFLRGEVARRVNLKFAPDIRFRVDERFDEAERIEKLLRTPAVQRDLNSDLEES

rbfA

Ribosome-binding factor A

138 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.774 kDa

MPRHHQKNSGREASQRQLRVGESVRHAIAEILAQGGVHDPVLEGHLVTVPEVRMSPDLKLATIYVMPLGGRDTELVLKALDHNKKFLRGEVSRRVNLKFAPELRFRADDRFDEAERIEKLLRTPAVQRDLQHDSDESE

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.388 kDa

MAKEFGRPQRVSQELQKEIAIILQREIKDPRLGMMVTVSGVDVSRDLAYAKVFVTFLNDKDEAAIKGGLRALGDASGYIRTLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTNVVRNDEERRGPAEENPEEGKAE

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.498 kDa

MPRHNKKDSTSGASQRQLRVAETVRHAIADILAQGHVHDPVLEGHLITVPEVRMSADLKLATIYVMPLGGRDTTDVIDALDHNRKFLRGEIARRVNLKFAPDIRFRADERFDEAERIEKLLRTPAVQRDLAPDSDES

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.613 kDa

MPRRHQPEKHPGGSHRQLRVAETVRHAIADILAQGQVHDPVLEGHLVTVPEVRMSADLKLATIYVMPLGGRDTADVIDALDRNRKFLRGEIARRVNLKFAPDIRFRVDERFDEAERIEKLLRTPAVQRDLAPDTDES

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

16.13 kDa

MKPLRKERLQQAIKQELSKILLEDMNDERLKFVTITDVELSDDQKYLKVYFSTMPGKNSEQILQSLERVKGYVSGEVARTLRLRFAPEIKFELDNSIERGVRMVKLLEDLEKKDEVKEDESHEDESTDHTEETNEEP

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.271 kDa

MSSRRLLKAAEAIREVVANAIVTEVRDPRVRDVTVIGVEVSPDMREAKVKVSVMGDETQKNLSLRGLQNSAGFLQSKIANRMDTRYTPKLRFEVDRGQENAMTVSEILARIQQEKEGATDDRDQNDSGEDATPHSND

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.503 kDa

MSKPTNSAPSQRMLRVGEQVRAAITQVLQRGEVRDDLIEKTVISISEVRMSTDLKVATAYVSPLGVSDHDTVIAALNRHAKYIRGRIGGQLRQMKYMPEVRFRDDTSFDNYQKIDALLRSPEVARDLGPDEDKQEDE

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.692 kDa

MSRHRRPQGFNRTDRVADQIQRELSRLLQFEMKDPRVNLATIQDVTVSRDLSYAEVYFTLLGQGEEAGAEAEEVLTKASGFLRSSLAQGLNTRTTPKLRFHYDMTPERAAHLSQLIDEARAEDRELRPEDDETGNNE

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.681 kDa

MAREFSRTRRIGQQLQQELAFVLQRDMKDPRIGMVTVNDVDVSRDLSHAKVYVTFFEEDPQVIEAKLAALNTAAPYARTLVAGRMKLRVMPELRFIYDASLVEGMRMSNLVSKVIRDDEAKKGHIGDEPQEGQREED

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.007 kDa

MATNRRVERVASLIKREVSQMLMSGIKDDRVGAGMVSVTDVVVSGDLQHTKIFVSIYGTPEAKAETMEGLKSAASYVRSELGQRVRLRRTPEVIFVEDKGLERGTQVISLLEQLTREREAREAAQAAAGVVDSTEDA

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.007 kDa

MATNRRVERVASLIKREVSQMLMSGIKDDRVGAGMVSVTDVVVSGDLQHTKIFVSIYGTPEAKAETMEGLKSAASYVRSELGQRVRLRRTPEVIFVEDKGLERGTQVISLLEQLTREREAREAAQAAAGVVDSTEDA

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.483 kDa

MSRQHQKSSPPGGSTRSLRVGELIRHAVAEILAQGGVHDPVLESHLVTVPEVRMSPDLKLATIYVMPLGGRDEKLVIDALEHHKRFLRGEIAHRVNLKFAPELRFRIDERFAEAERIDKLLRSPAVQKDLEPNSDQD

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.334 kDa

MPKHHQKAQSPGGSQRQLRVGEIVRHAVAELLSQGGVHDPVLEGHLITVPEVRMSPDLKLATVYVMPLGGRDTDVVLKALAANKPFIRTAVARRVNLKFAPDLRFRIDERFDEAERIEKLLRTPGVQKDLQQDSDET

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.483 kDa

MSRQHQKSSPPGGSTRSLRVGELIRHAVAEILAQGGVHDPVLESHLVTVPEVRMSPDLKLATIYVMPLGGRDEKLVIDALEHHKRFLRGEIAHRVNLKFAPELRFRIDERFAEAERIDKLLRSPAVQKDLEPNSDQD

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.587 kDa

MAHRSHTGTGPSQRQLRVGELIRRTLADVLNRGEIHDPELNRLSITVGEVRCSPDLKVATVHVMPLGGKNVEEAIALLSKHRGELRHHITRQMTLKYAPDLRFRPDETFDRLDETRRLFSDETVMRDIRGGGEADED

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.588 kDa

MAHRSHTGTGPSQRQLRVGELIRRTLADVLNRGEIHDPELNRLSITVGEVRCSPDLKVATVHVMPLGGKDVEEAIALLSKHRGELRHHITRQMTLKYAPDLRFRPDETFDRLDETRRLFSDETVMRDIRGGGEADED

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.534 kDa

MAIARRISRIASLIKQEISQMLLHGIKDNRVGIGMVSVTDVDVSGDLQHAKVFVSIYGSDEVRSQTMAGLRSATGYVRSELGKRIRMRRTPEVIFVEDRSLERGTEILSLLNKLSQERQQQEIEDITHKESHQDTIE

rbfA

Ribosome-binding factor A

137 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.774 kDa

MSKEFSRTQRVSQQLQKELALILQREVRDSRIGMVTISDVEVSRDLAYAKVFVTFLCIGEQTPESCLAALKEHEVPVRMALGKRIRHRLTPEVRFTYDNTLVEGMRMSNLVSEVLNDDKRKQEESGRTDETQSKGEE

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.306 kDa

MPREFTRSDRVSDAIQRLLAQVIPQEVRDPRLGMVNINAVAVSRDMAFAKVYVTFVGVTDEPKSLEGIGILNKASGFLRSFVARELSMRTVPKLQFIYDKTSIRGQELSSLIDRAIAEDRLHPQGDQTDDQQEGRD

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.429 kDa

MAREFSRTQRVAQEMQKEIAIILQREVKDPRIGMATVSGVEVSRDLAYAKVFVTFLNVLTEEHDSDVVKNGIKALNEASGFIRSLLGKAMRLRVVPELTFSYDNSLVEGMRMSNLVTNVVKNDEQRRASTDHKEEK

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.263 kDa

MAKEFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSLIEGMRMSNLVSNVIKNDVERQVNPGSDEEK

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.263 kDa

MAKEFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSLIEGMRMSNLVSNVIKNDVERQVNPGSDEEK

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.277 kDa

MAKEFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSLIEGMRMSNLVTNVIKNDVERQVNPGSDEEK

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.263 kDa

MAKEFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSLIEGMRMSNLVSNVIKNDVERQVNPGSDEEK

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.263 kDa

MAKEFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSLIEGMRMSNLVSNVIKNDVERQVNPGSDEEK

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.263 kDa

MAKEFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSLIEGMRMSNLVSNVIKNDVERQVNPGSDEEK

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.263 kDa

MAKEFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSLIEGMRMSNLVSNVIKNDVERQVNPGSDEEK

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.263 kDa

MAKEFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSLIEGMRMSNLVSNVIKNDVERQVNPGSDEEK

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.263 kDa

MAKEFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSLIEGMRMSNLVSNVIKNDVERQVNPGSDEEK

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.263 kDa

MAKEFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSLIEGMRMSNLVSNVIKNDVERQVNPGSDEEK

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.346 kDa

MRHKEQSEGPSVRVLRVGEQVRHVLSEILARGDVHDDVLATHPVSVTEVRMSPDLRHATVFVKPLLGKDEEAVLKAMRTNTAYLQREVAHRIRMKYAAKLKFLADDSFDEASHIDRLLRDPKVARDLEGGDEGDQG

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.119 kDa

MRKNSIKNTRINQEVQKELSMLISRELKDPRINPMTSIVAVEVAPDLKTAKVYISVLGDELSQKNTLAGLKSAAPFLRGQLARGINLRNTPELLFVVDQSIEYGVSMSKLINEVNAGNHKASDEEESDDKGHEDEQ

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.461 kDa

MTRPTSSAPSQRMLRVGEQVRAAITQVLQRGEVRDDIIEATVISISEVRMSPDLKIATAYVTPLGVSDHSIVIEALNRHAKFIRGRLGPQLRQMKYMPEVRFRDDTSFDNYKKIDELLRSPEVSRDLDSDSDSDEK

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.063 kDa

MAKEFSRGQRVAQEMQKEIAIILQREVKDPRVGMATVSGVEVSRDLAYAKVYVTFLNVLTENADPNLVPNGIKALEDASGYIRTLLGKAMRLRVVPELTFAYDNSLVEGMRMSNLVTNVVKNDAERRSASGDDEEA

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.066 kDa

MNTAGPAGKLAGHAASGPTQRQLRVGEEVRRMLADLFARTEFRDPELVDVRITVTEVRISPDLKHATAFVARLGRSDVETLLPALKRVAPFLRSRLSTGLRLRGVPEIHFQPDTALDYAMEVDALLRQPDVARDLD

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.041 kDa

MSRHKSKSIPGRNLRLADQIQKDLAGLIQRELDMSRAGLITLSGVELSADYAHAKVYFTVLGAEPDAAAALLNEKAGWLHSQLYKLLHIHTVPTLRFVHDAQIARGIEMSALIDRANRPGPAADEPDEPDEPEDRR

rbfA

Ribosome-binding factor A

136 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.506 kDa

MSRHQKPTGQSESPRKLRVGELVRHAVAEILAQGGVHDPVLETHLITVPEVRMSPDLKLATVYVMPLGGRDEKLVIAALEQHKRFLRGEVARRVNLKYAPEIRFRIDERFAEAERIEKLLRTPAVQKDLEPDSDQD

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.825 kDa

MQFERADRVAEEIKKEISDIIQHELKDPRICAELISIVKVNMSKDLRHAKVFVSIFDKNRENITSTMKALENAKPYIRREISRRINLRFSPEISFELDDSIEYGARISQILNQLNIAKDEEEEKSQDESEGEQEN

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.252 kDa

MTRSTSSAPSQRMLRVGEQVRAAITQVLQRGEVRDPLIEKTVISISEVRMSPDLKIATAYVTPLGVADHAAVIEALNKHAKFIRGRLGPQLRQMKYMPDVRFRDDTSFDNYQKIDALLRSPEVSRDLDPDTDDQE

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.246 kDa

MARRQTPPGLPSQRQLRAGEIVRHALAEIISREDFRDPDLSNVIVTVGEVRCSPDLKHANIFVTPLGDDSEEGRKRLADALTRAKGFLRTRLGREIELKFTPELHFIADSSYDEATAIDRLLNDPRVRRDVESEG

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.42 kDa

MARSRFDTGSGPSQRQLRVGELIRRTLSSVLNQGDIHDPDLNRMSITVGEVRTSPDLKVATAYVLPLGGHGAQDALDALRRNRHELRRAVSKELTLKFSPELRFQIDETFDRMDETRRLLSQDHVRQDLDKPDED

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.367 kDa

MAKQQTSPETRSVRLLKVGEQVRHILSELLARQEVHDDVLSAHTVSVTEVRMSPDLRHATVFIKALLGEDEDLVLKALRTNTAFFQREVAQRLRLKYAARLKFLADESFDVASKIETLLADPKVQRDLRDQESDG

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.405 kDa

MKNAEPSQRQLRVGEQVRHAVAHILQQGILLDNLLKNMVISVVEVRMSPDLKIAICFVSPLSTVHNASRADVVNALNKHSRFIRGEISHSLRQMKYMPELRFRLDNSFDNFSKIDALLRSPEVARDLHHNDKVGD

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.596 kDa

MKNAGPSQRQLRVGEQVRHAVAYKLQQGILLDDLLKNIVISVAEVRMSPDLKIATCFVSSLSTLHNVSPTDVVNVLNKHSRFIRREISYSLRQMKYMPELRFRLDTSFDNFSKIDSLLRSPEVARDLHHNDEFKD

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.424 kDa

MKNAGPSQRQLRVAEQVRHAVAHILQRGILLDDVLKDIVISVSEVRISPDLKIATCFVSPLSTLKNTSHTDVVNTLNKHSRFLRGEISHALRQMKYMPELRFRLDNSFDNFSKIDALLRSPEVARDLHHSDKDED

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.183 kDa

MAKSTSSAPSQRMLRVGEQVRAAITQVLQRGEVLDPLIENTVISISEVRMSPDLKIATAYVTPLGVADHAAVIEALNKHAKFIRGRLGPQLRQMKYMPDVRFRDDTSFDNYQKIDSLLRSPEVSRDLDRDADDEE

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.523 kDa

MSKEFSRTQRVSQQLQKELAVMLQREVRDSRIGMVTISDVEVSRDLAYAKVFVTFFCVGEQTPESSLAALKEHEPSLRMMLGKRIRLRLTPEIRFTYDNTLVEGMRMSNLVTDVVNTDKRKMAESGRTESDEGEE

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.509 kDa

MSKEFSRTQRVSQQLQKELAVMLQREVRDSRIGMVTISDVEVSRDLAYAKVFVTFFCVGDQTPESSLAALKEHEPSLRMMLGKRIRLRLTPEIRFTYDNTLVEGMRMSNLVTDVVNTDKRKMAESGRTESDEGEE

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.499 kDa

MSKEFSRAQRVSQQLQKELAVILQREVRDSRIGMVTISDVEVSRDLAYAKVFVTFFCVGEQTPETCLAALKEHEVPVRMMLGKRIRHRLTPEVRFTYDNTLVEGMRMSNLVSDVVNTDKRKMAESGRTESDEGEE

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.463 kDa

MRKPTESAGPTQRQQRVAELVRHAIAEVLSRGDLQDPVLSRHVITVPEVRMSPDLKLATAYVMPLGGEDEQPVIEALERNRKVLRQEVARRVNLKFAPDLRFRRDETFDEAARIDRLLRSDKVQRDLGPDRDSGE

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

14.964 kDa

MAREFSRLDRVAEQIQKELAQLIQRELKDPRLGMVTVNSVKVSKDLSYADVYVTVLNLKDVEDDGDASKASLKVLESAAGFLRSELGRAIKLRVMPQLRFHYDASVSNAQRLGALIQKARAKDSSASDSSDDSHN

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.271 kDa

MPRNEKKTGQSASPRKLRVGELVRHAVAEILSQGGVHDPVLETHLITVPEVRMSPDLKLATVYVMPLGGKDEKPVLAALEQHKRFLRGEVARRVNLKYAPDLRFRIDERFAEAERIEKLLRTPAVQKDLSGEEET

rbfA

Ribosome-binding factor A

135 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.74 kDa

MSKEFSRTQRVSQQLQKELAMILQREVRDSRLGMVTISDVEVSRDLAYAKVFVTFLCVGEQTPESCLAALREHEVHIRMMLGKRIRLRLTPEIRFYYDNTLVEGMRMSNLVSEVVNEDKRKQQDSGREEDQAGEE

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.109 kDa

MAKSTSSAPSQRMLRVGEQVRAAITQVLQRGDVRDPLIESTVISISEVRMSPDLKLATAYVTPLGVADHAAVIEALNKHAKFIRGRLGPHLRQMKYMPDVRFRDDTSFENYQKIDSLLRSPEVSRDLDRDSDEE

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.536 kDa

MKHADLSQRQLRVGEQVRHALAHMLQRGILLDDALKDVVFSVSEVRMSPDLKIATCFVSFLNTVDDISRATLIKVLNKHSRFIRGEISSSLRQMKYMPELRFRLDNSFDNFSKIDALLRLPEVARDLHHHKPED

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.488 kDa

MANVYSRKKRIAHEIQKKINISLQHNIRDPRLRKTTISWVSVSHDLGSATVFVIFNGIQNDNQTSEEIKKRIKTLQAASGFIRYLLGKTMHLRIVPKLTFVYDQSLSHGIYIHELVNKIIREDHKSLIKNGIVN

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.277 kDa

MKNMGDGRRIARVEREIQATIAQFLIRGFKTPLPGLVTVASVKMPADLRAAKVYVSILGDEKQQDEALDLLQERAFEIQNYIGKELKMRYCPKLTFYLDHATEQVLKVEKILHELELERKANNPGEGSDESDDE

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.344 kDa

MNQRLQRLADQIQRELAVLIRDAVNDPRLTGFVTISSVKVSPDLGYADVYVTIMEPELNDAMTMSNHEESIKVLNKAAGFLRTELSHSLKTRTTPRLRFHYDEVTARGNYMMDLISKAVIKTEENESDEQENEE

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.358 kDa

MNQRLQRLADQIQRELAVLIRDAVNDPRLTGFVTISSIKVSPDLGYADVYVTIMEPELNDAMTMSNHEESIKVLNKAAGFLRTELSHSLKTRTTPRLRFHYDEVTARGNYMMDLISKAVIKTEENESDEQENEE

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.241 kDa

MTRPTSSAPSQRMLRVGEQVRAAITQVLQRGEVRDDIIEATVISISEVRMSPDLKIATAYVTPLGVSDHSIVIEALNRHAKFIRGRLGPQLRQMKYMPEVRFRDDTSFDNYKKIDELLRSPEVSRDLDGDNDDQ

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.269 kDa

MTRPTSSAPSQRMLRIGEQVRAAITQVLQRGEVRDDVIEATVISVSEVRMSPDLKIATAYVTPLGVSDHSIVIEALNRHARFIRGRLGPQLRQMKYMPEVRFRDDTSFDNYKKIDELLRSPEVSRDLDGDNDEQ

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.276 kDa

MTRATSSAPSQRMLRVGEQVRAAITQVLQRGEVRDDVIEATVISISEVRMSPDLKIATAYVTPLGVSDHSVVIEALNRHARYIRGRLGQQLRQMKYMPEVRFRDDTSFDNYKKIDELLRSPEVSRDLDGDNDEQ

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

14.993 kDa

MAQGRRVERVAALIRKETSELLINGIRDERVHKGMVSITSVEVAGDLQHCKIFVSIFGEPNDQNEVMEGLEAASGFLRGELGRRLQMRRAPEVKFQLDRGLEKGTSVLGLLNQLEDQRQERGEIPPGSDELQPD

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.391 kDa

MAKEFGRADRVAQQIQREIAVILQREVKDPRVGMVTVSDVELTRDLQHAKIFVTFFLNEVDDIEAGVKVLNDASGYIRILMGKAMKLRVVPEIRFVYDKTLVEGMRISNLVTNTVRDDQLRRGESPDQNEEDRD

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

14.885 kDa

MAQGRRVERVAALIRKETSELLINGIRDERVHQGMVSITNVEVSGDLQHCKIFVSIFGDEASQLQVMEGLQAASGYLKGELGRRLQMRRAPDVVFQLDRGIERGTSVLGLLNKLEDERKERGEIPAGSDELPAE

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.144 kDa

MAQGRRVERVAALIRKETSELLIHGIRDERVHQGMVSITEVEVSGDLQHCRIFVSVFGEQAQKDEVMDGLEAARGFLRGELGRRLQMRRAPEIVFKLDLGIEKGTTVLHLLGELERERDERGDVTEGTELPDNP

rbfA

Ribosome-binding factor A

134 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

14.905 kDa

MATDRRVARVAELIKREISQMLMSGIKDDRVGSGMVSVTDVDLSGDLQHAKIFVSIYGTEAARAETMAGLKAATGYVRSELGHRVRLRRTPEVVFLEDRSLERGTQVLSLLNRLSEERQKNADLDEMAAEEPES

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.009 kDa

MPSSAPSQRQLRVGEQARHALSDVLQREDMRDPALEGAVISVSEVRMSPDLKIATVFVSPLSGDKEAIIAALNRHARYIRGRVSPALRQMKYMPEFRFHLDTSYENFEKIDRILRSPEVARDLGDADDEDDNG

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

30S ribosome-binding factor

133 amino acids

One of at least 4 proteins (Era, RbfA, RimM and RsgA/YjeQ) that assist in the late maturation steps of the functional core of the 30S subunit. Essential for efficient processing of pre-16S rRNA (PubMed:9422595, PubMed:12963368, PubMed:12628255). Probably part of the 30S subunit prior to or during the final step in the processing of 16S free 30S ribosomal subunits. Probably interacts with the 5'-terminal helix region of 16S rRNA (PubMed:7535280). Has affinity for free ribosomal 30S subunits but not for 70S ribosomes (PubMed:7535280, PubMed:12963368). Overexpression suppresses a cold-sensitive C23U 16S rRNA mutation (PubMed:7535280). Overexpression decreases the lag time following cold-shock by about half, leading to faster adaptation and increased protein synthesis (PubMed:8898389). Overexpression also partially suppresses a rimM deletion mutant and partially rescues its 16S rRNA processing deficiency (PubMed:9422595). Its function overlaps that of Era in ribosome biogenesis (PubMed:16825789). A number of RbfA mutants suppress RsgA/YjeQ deletions, in all cases less RbfA is bound to the 30S ribosome (PubMed:21102555). Released from 30S ribosomes by RsgA; stimulates the ribosome-associated GTPase activity of RsgA (PubMed:21102555).

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.165 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRVGMMTTVSGVEMSRDLAYAKVFVTFLNDQDEAAVKNGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTTVVKHDDERRVNPDDEKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.05 kDa

MARDFSRAQRVSQEMQKEIAIILQREVKDPRIGMATVSGVEISRDLAYAKVFVTFLNLSAGEESDEEMVENGLKALNEAAGFIRSLLGKAMRLRVVPELTFAYDNSLVEGMRMSNLVSNVVKDDEKRRHKEEE

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.154 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.096 kDa

MAKEFGRPQRVAQEMQKEIAIILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEAAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDDERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.096 kDa

MAKEFGRPQRVAQEMQKEIAIILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEAAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTSVVKHDDERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.15 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRVGMMTTVSGVEMSRDLAYAKVFVTFLNDQDEAAVKNGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTNVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.182 kDa

MAKEFGRPQRVAQEMQKEIAIILQREIKDPRLGMMTTVSGVEMSRDLAYAKVYVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTNVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.15 kDa

MAKEFGRPQRVAQEMQKEIALILQREIKDPRVGMMTTVSGVEMSRDLAYAKVFVTFLNDQDEAAVKNGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTNVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

15.166 kDa

MAKEFGRPQRVAQEMQKEIAIILQREIKDPRLGMMTTVSGVEMSRDLAYAKVFVTFLNDKDEDAVKAGIKALQEASGFIRSLLGKAMRLRIVPELTFFYDNSLVEGMRMSNLVTNVVKHDEERRVNPDDSKED

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

14.918 kDa

single

EFSRSQRVSQEMQKEIALILQREIKDPRVGMATVSGIELSRDLAYAKVFVTFLNVLTDNADPDTAKNGIKALQDASGYIRTLLGKAMRLRIVPELTFAYDNSLIEGMRMSNLVTNVIKNDVERQVNPGSDEEK

rbfA

Ribosome-binding factor A

133 amino acids

One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA.

Belongs to the RbfA family.

14.666 kDa