ramS

Lanthionine-containing peptide SapB

43 amino acids

Lanthionine-containing peptide devoid of antibiotic properties, involved in the formation of aerial mycelium. Suggested to self-assemble at air-water interfaces, thus providing a film of surfactant through which nascent aerial hyphae can emerge. The aerial hyphae differentiate further into spores (By similarity).

Belongs to the lanthionine-containing morphogen protein family.

4.506 kDa

MALLDLQAMDTPAEDSFGELATGSQVSLLVCEYSSLSVVLCTP

ramS

Lanthionine-containing peptide SapB

43 amino acids

Lanthionine-containing peptide devoid of antibiotic properties, involved in the formation of aerial mycelium. Suggested to self-assemble at air-water interfaces, thus providing a film of surfactant through which nascent aerial hyphae can emerge. The aerial hyphae differentiate further into spores (By similarity).

Belongs to the lanthionine-containing morphogen protein family.

4.591 kDa

MALLDLQAMDTPAEDSFGELRTGSQVSLLVCEYSSLSVVLCTP

ramS

Lanthionine-containing peptide SapB precursor RamS

42 amino acids

Lanthionine-containing peptide SapB: Lanthionine-containing peptide devoid of antibiotic properties (PubMed:15277670). A surface active peptide involved in the efficient formation of aerial mycelium when cells are grown in rich media. Has an overlapping function with the surface-active chaplin proteins; chaplins are essential on minimal medium while on rich medium both chaplins and SapB are required for efficient aerial hyphae formation (PubMed:17462011). Required under conditions of high osmolarity where it may change the physical properties of the chaplin layer to allow hyphae to grow into air (Probable). Suggested to self-assemble at air-water interfaces, thus providing a film of surfactant through which nascent aerial hyphae can emerge; the aerial hyphae differentiate further into spores (PubMed:2032288). Application to bald mutants (bld, unable to make aerial hyphae) restores hyphae growth (PubMed:2032288, PubMed:9822824). Application to chaplin negative mutants as well as ramC-ramS-ramA-ramB and ramR deletions also restores aerial hyphae growth and sporulation (PubMed:17462011). Reduces surface tension of water from 72 to 30 mJ/m(2) (PubMed:9822824).

Belongs to the lanthionine-containing morphogen family.

4.496 kDa

MNLFDLQSMETPKEEAMGDVETGSRASLLLCGDSSLSITTCN

ramS

Lanthionine-containing peptide SapB

42 amino acids

Lanthionine-containing peptide devoid of antibiotic properties, involved in the formation of aerial mycelium. Suggested to self-assemble at air-water interfaces, thus providing a film of surfactant through which nascent aerial hyphae can emerge. The aerial hyphae differentiate further into spores (By similarity).

Belongs to the lanthionine-containing morphogen protein family.

4.496 kDa

MNLFDLQSMETPKEEAMGDVETGSRASLLLCGDSSLSITTCN