About Services Proteins Contact

queD

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Helicobacter pylori (strain J99 / ATCC 700824)
Length
200 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
23.63 kDa
Sequence
MVIRRLYKFCASHVVRNCSSLKCAQNIHGHNYEVEVFIETNRLDNANMALDFGLMQQEMQTFIDSFDHAHHFWDKESPEFQRFIENHCVRYVKCSFNLSAESYALMFLYYLTKILQKSVFSNNEGELKVSSVRVHETKNGYAESFLKDLENPHFKSLVHDHCVSFSQGIQSLWHDKDFFHKIISDEKQCFFHAKPLHQIP

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Helicobacter pylori (strain ATCC 700392 / 26695)
Length
200 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
23.663 kDa
Sequence
MVIRRLYQFCASHVVRNCSSLKCAQNIHGHNYEVEVFIETNRLDNANMALDFGLMQQEMQVFIESFDHAHHFWDKESLEFQRFIENHCVRYVKCSFNLSAESYALMFLYYLTKILQKSVFSNDEGELKVSSVRVHETKNGYAESFLKDLENPHFKSLVHDHCVSFSQGIQNLWHDKDFFNKIISDEKQCFFHAKPLHQIP

Gene
queD
Protein
Putative 6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Length
163 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
18.816 kDa
Sequence
MMLELNGLHAGLRFSSAHIVFGHPTCGVIHGHSYYVDVKLYGERAGDFKFVCDFKIIKKIVKEICDELDHKLILPKNHEHVYYELRDKTLYFKYENKEYSIPVEDVILLPIPSTTAEDLAIYFANEIADRLKNLGFSNINWIEVSINEGIGQGACYRKYLEVK

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Aquifex aeolicus (strain VF5)
Length
162 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
18.719 kDa
Sequence
MKWEISKTFRFEAGHRVWKQNLTYGRGAQFTKEKPVNKCVNLHGHSYVLEVTVGSDTLSEQDMVMDFYHVKNALKGLIEEIDHSFIIDVNDPMYPELKDVAEKYGAMKIFPVEFCPTAEALAKFFYDFLKKRLEEAGLLGEVKVVKVVLWETATSKAEYKEE

Gene
queD
Protein
Putative 6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Length
161 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
18.062 kDa
Sequence
MVMMKIVINGIHANLRFSAAHMIPEHESCGCIHGHSYIVDVKVEGKRSGKHGFVADFKDVKDIVRRICSEFDHKLLIPLRNPLINFTSTTRTVKFEIAGKKYSIPEEDCCLMDLESSSAEELSRYFAATLFKELSSKYDISSVEVCVNEGIGQGAIYTISR

Gene
queD
Protein
Putative 6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Pyrococcus abyssi (strain GE5 / Orsay)
Length
157 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
18.742 kDa
Sequence
MKRVVSIKRRIYWTKEFDSSHFLELEYESKCRRLHGHTYRVEVEIEGEPNEHGMIFDFNHLSELIKTLDHKVIVSEKWVRYEEGYVLIEKNDKLLKLPRSEVVVIDKPNVTAEYIAEWISERILENAGENVREIRVRVWEDPRSYAEITLTLKPQGS

Gene
queD
Protein
Putative 6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Length
157 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
18.629 kDa
Sequence
MTMRYIIKRKIYWTKEFDSSHFLELEYESKCKRIHGHTYKVEVEIEGELNEEGMIFDFTHLSEIVKELDHRLIVSKEWVKEVGDLVIIEKNRKILKVPRDEVVIIDKPNVTAEYLAEWFGERIAENAGSNIKKIKVRIWEDPRSYAEVTFTLEPQGS

Gene
queD
Protein
Probable 6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Length
150 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
16.234 kDa
Sequence
MRSAQSKRSQSTATGERTLHIGRDRPIRISAGHRLQHHDGKCSRPHGHNYEISVEITGQLTDEGWVVDKGTVTAVVSDWDHRFLLEDGDPLVDAFREAGDGDAVVVLEQPPTAEVMGVVLERKLHDALPETVSAVSVTVAETPALTAGPN

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Bacillus subtilis (strain 168)
Length
146 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
16.468 kDa
Sequence
MLSQIYPQAQHPYSFELNKDMHISAAHFIPRESAGACSRVHGHTYTVNITVAGDELDDSGFLVNFSVLKKLVHGNYDHTLLNDHEDFSQDDRYSLPTTEVVAKTIYDNVQAYLDTLENKPTCVQVFVRETPTSYCVYRPKKGGLNG

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Length
141 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
16.322 kDa
Sequence
MFKISKEFSFDMAHLLDGHDGKCQNLHGHTYKLQVEISGDLYKSGAKKAMVIDFSDLKSIVKKVILDPMDHAFIYDQTNERESQIATLLQKLNSKTFGVPFRTTAEEIARFIFNRLKHDEQLSISSIRLWETPTSFCEYQE

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Rickettsia bellii (strain RML369-C)
Length
138 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
15.985 kDa
Sequence
MIKCTRRIEFDAGHRIIGHQNKCQYLHGHRYVLEITIAAKNTDELGMVVDFGLIKDLAKGWVDENFDHSLILHQGDKEIGQKIESHTGQKVYYLKNNPTAENIALHLKNEIFPKLFESQKFFVTNIKLFETPNCFVEV

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Length
138 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
16.144 kDa
Sequence
MIKCTRRIEFDAGHRIIEHQNKCQFLHGHRYVLEIAIAANKTDKLGMVIDFGLIKDLAKKWIDENFDHSLILHQDDKEMGQQIENCTGQKIYYMQNNPTAENIATHLKNEIFPKLFVSQNFFVTSLKLYETPNCFVEV

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Length
138 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
16.04 kDa
Sequence
MIKCTRRIEFDAGHRIIGHQNKCQFLHGHRYVLEIAIAANKTDKLGMVIDFGLIKDVAKKWIDENFDHSLILHQDDKEMGQQIENCTGQKIYYMQNNPTAENIATHLKNEIFPKLFVGQNFFVSNLKLYETPNCFVEV

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Rickettsia prowazekii (strain Madrid E)
Length
138 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
16.227 kDa
Sequence
MIKCTRRINFDAGHRIIGHKNKCQFLHGHHYVLEITIAANKTDTLGMVIDFGLIKNLAKKWIDANFDHNLILHQDDKEMGQQIENYTRQKIYYMRNNPTAENIATHLKNEIFPKLFVSQNFFVTSLKLYETQNCFVEV

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Length
138 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
16.192 kDa
Sequence
MIKCTRRIDFDAGHRIIGHKNKCQFLHGHHYVLEITIAANKTDKLGMVIDFGLIKNLAKKWIDANFDHNLILHQDDKEIGKQIENYTGQKIYYMRNNPTAENIAIHLKNEIFPKLFIDQNFFVTSLKLYETQNCFVEV

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Synechocystis sp. (strain PCC 6803 / Kazusa)
Length
129 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
14.538 kDa
Sequence
MWIIYKEFSFEAAHQLPHHEGKCRRLHGHSFRGRVYVASDRLKTTGSETGMVMDFSVLKAHLDPLVKNHLDHYYLNDSLGLESPTSEAIAAWIFAKLEEAGVPGLHSVEVLETCTSAARYFSPRLSPLL

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Shigella flexneri
Length
121 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
13.773 kDa
Sequence
MMSTTLFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPTYERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRGE

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Escherichia coli O157:H7
Length
121 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
13.773 kDa
Sequence
MMSTTLFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPTYERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRGE

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Escherichia coli (strain K12)
Length
121 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde. Can also convert 6-pyruvoyltetrahydropterin (PPH4) and sepiapterin to CPH4; these 2 compounds are probably intermediates in the reaction from H2NTP.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
13.773 kDa
Sequence
MMSTTLFKDFTFEAAHRLPHVPEGHKCGRLHGHSFMVRLEITGEVDPHTGWIIDFAELKAAFKPTYERLDHHYLNDIPGLENPTSEVLAKWIWDQVKPVVPLLSAVMVKETCTAGCIYRGE

Gene
queD
Protein
6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Length
120 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
14.273 kDa
Sequence
MKTIIFKDFQFEAAHYLPYVPKMHKCRRLHGHSFFVRLELKDKINEKNGWIIDYAEIKLAFQPIYDQLDHHFLNDIPGLENPTSEILAKWIWHRLKPKLSILNTIIIKETCTSGCIYQGF

Gene
queD
Protein
Putative 6-carboxy-5,6,7,8-tetrahydropterin synthase
Organism
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Length
115 amino acids
Function
Catalyzes the conversion of 7,8-dihydroneopterin triphosphate (H2NTP) to 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) and acetaldehyde.
Similarity
Belongs to the PTPS family. QueD subfamily.
Mass
13.15 kDa
Sequence
MEEEMIIGISTSFSAAHSIPGHKKCGKVHGHNFKVEVEISGKVKENGMVMDFFDLKRIVNEVVAKFDHTLLNEQIEIPTSENICLRIFSELAEKGLNVRRVRVAENEDKWAEIRR