About Services Proteins Contact

qcr6

Gene
qcr6
Protein
Cytochrome b-c1 complex subunit 6
Organism
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
214 amino acids
Function
Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c. Qcr6 may mediate formation of the complex between cytochromes c and c1 (By similarity).
Similarity
Belongs to the UQCRH/QCR6 family.
Mass
24.308 kDa
Sequence
MSFWKNLFTSAFTPISAEADELIKEDRKQFEENTPSKKNFETQSPDEPSPKTTDSTGARDANLSLKTQEPIVSADDAKGAQGKGADEKEEKKETIQPPEEVKTEPPQPEEKEGKEAKEPEEPPKEEAEEPQEGGEEEEEEEEEEEITDPLEKMTQECMDAPDCKEVKHHFEECTARVTKKVEQGDKSEDCIEEFFHLYHCARDCADPKVFKVLV

Gene
QCR6
Protein
Cytochrome b-c1 complex subunit 6
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
147 amino acids
Function
Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c. QCR6 may mediate formation of the complex between cytochromes c and c1.
Similarity
Belongs to the UQCRH/QCR6 family.
Mass
17.257 kDa
Sequence
MGMLELVGEYWEQLKITVVPVVAAAEDDDNEQHEEKAAEGEEKEEENGDEDEDEDEDEDDDDDDDEDEEEEEEVTDQLEDLREHFKNTEEGKALVHHYEECAERVKIQQQQPGYADLEHKEDCVEEFFHLQHYLDTATAPRLFDKLK