purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.018 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIESVEKSCFQKGYTLILGNAWNDPEKQRAYLSMMAQKRVDGLLVMCSEYPDSVLSMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFQGGYIAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMQAMKEAHISVPENWIVQGDFEPESGYRAMQQILSQQHRPTAVFCGGDIMAMGAICAADEMGLRVPQDISLIGYDNVRNARYFSPALTTIHQPKDSLGEAAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFVDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.061 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIESVEKSCFQKGYTLILGNAWNDLEKQRAYLSMMAQKRVDGLLVMCSEYPDSVLSMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFQGGYIAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMQAMKEAHISVPENWIVQGDFEPESGYRAMQQILNQQHRPTAVFCGGDIMAMGAICAADEMGLRVPQDISLIGYDNVRNARYFSPALTTIHQPKDSLGEAAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFVDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.938 kDa

MATIKDVAKRAGVSTTTVSHVINKTRFVAEETKAAVRAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEIIEAVENSCYAKGYTLVLCNSHNDIGKQRAYLSMLAQKRVDGLLVMCAEYPPELLGMLEDYRSIPMVVMDWGQMHNDFTDTIIDNAFEGGYMAGRYLIERGHRDIGAIPGIQERNTGSGRYLGFLKALKEADITVRNEWVVQGDFEPESGYKAMHQILAQKQRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRHARFFTPALTTIHQPKERLGQSAFSMLLDRITSKREDAHVIEVHPTLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.896 kDa

MATIKDVAKRAGVSTTTVSHVINKTRFVAEETKAAVRAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEIIEAVENSCYAKGYTLVLCNSHNDIGKQRAYLSMLAQKRVDGLLVMCAEYPPELLAMLKDYRSIPMVVMDWGQMHSDFTDTIIDNAFEGGYMAGRYLIERGHRDIGAIPGIQERNTGSGRYLGFLKALKEADITVREEWVVQGDFEPESGYKAMHQILAQKQRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRHARFFTPALTTIHQPKERLGQSAFAMLLDRITSKREDAHVIEVHPTLIERRSVADGPYLDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.913 kDa

MATIKDVAKHAGVSTTTVSHVINKTRFVAEDTKAAVWAAIKALNYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEIIESVENSCYSKGYTLILCNSHNNIDKQKAYLAMLAQKRVDGLLIMCSEYPEQLLGMLEDYRNIPMVVMDWGQARSDFTDTIIDNAFHGGYLAGRYLIERGHRDIGAIPGPLARNTGGGRHQGFLKALKEANIPIKEEWVIQGDFEPESGYKAMHQILNQKQRPTAVFCGGDVMAMGAICAADELGLRVPQDISVIGYDNIRNARYFSPALTTIHQPKERLGQMAFSMLLDRIINKREDAQTIEVHPRLVERRSVVDGPFVDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.889 kDa

MATIKDVAKRAGVSTTTVSHVINKTRFVAENTRAAVWAAIKELNYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQKAYLAMLAQKRVDGLLVMCSEYPDHLLSLLEGYRNIPMVVMDWGKARGDFTDTIIDNAFHGGYIAGRYLIERGHRDIGIIPGPLERNTGGGRLQGFLKAMEEAKITVKEEWIVQGDFEPESGYKAMTQMLNQKQRPTAVFCGGDVMAMGAICAADELGLRVPADISIVGYDNIRNARYFTPALTTVHQPKERLGQMAFSMLLDRIVNKREDAQTIEVHPRLVERRSVADGPFIDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.032 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARFFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.105 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFEGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALIKVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARFFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.048 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.165 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.165 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.165 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.164 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPQSWIVQGDFEPESGYRAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. In addition, it participates in the regulation or coregulation of genes involved in de novo pyrimidine nucleotide biosynthesis, salvage and uptake (pyrC, pyrD, carAB and codBA), and of several genes encoding enzymes necessary for nucleotide and polyamine biosynthesis (prsA, glyA, gcvTHP, speA, glnB). Binds to a 16-bp palindromic sequence located within the promoter region of pur regulon genes. The consensus binding sequence is 5'-ACGCAAACGTTTTCNT-3'. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.165 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.864 kDa

MATIKDVAKRAGVSTTTVSHVINKTRFVADETKAAVWEAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIESVENSCYGHGYTLILCNSHNNLEKQKAYLAMLAQKRVDGLLVMCSEYPENLLESLEDYRHIPMVVMDWGTRRSDFTDAIQDNAFEGGYLAGRYLIERGHRDIGAITGPVSRNTGGGRLRGFLKALQEASITPLESWLVEGDFEPESGYTAMQNILSQKQRPTAVFVGGDIMAMGAICAADEMGLRVPQDISVIGYDNVRNARYFTPALTTIHQPKERLGAMAFDMLLDRITSKREDAQTIEVHPKLVERRSVADGPFIDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.967 kDa

MATIKDVAKRAGVSTTTVSHVINKTRFVADETREAVWVAIKELHYSPSAVARSLKVNHTKTIGLLATSSEAPYFAEIIEAVENSCFAKGYTLILGNAHNNIEKQQAYLSMMAQKRVDGLLVMCSEYPDALISMLEDHRNIPMVVMDWGKSRGDFTDTVLDNAFEGGYLAGRYLIERGHRDIAAIPGQLERNTGGGRHAGFLKALTEAGIVLREEWLVQGDFEPESGYRAMQQILAQKQRPTAVFCGGDIMAMGAICAADEMGLRVPQDISVIGYDNVRNARYFTPALTTVHQPKERLGETAFNMLLDRITSKREESQTIEVYPTLIERRSVADGPYRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.188 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLTMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALIKVPENWIVQGDFEPESGYRAMQQILAQTHRPTAVFCGGDIMAMGALCAADEMGLRVPQDISVIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.048 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.048 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.048 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.048 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.032 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARFFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.078 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWTAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.048 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.048 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.078 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWTAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.048 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.032 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARFFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.048 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.783 kDa

MATIKDVAKRAGVSTTTVSHVINKTRFVAEETKAAVGAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQRAYLAMLAQKRVDGLLVMCSEYPDQLLGMLEDYRNIPMVVMDWGAARGDFTDSIIDNAFAGGYLAGRYLIERGHRDIGAIPGQLSRNTGGGRHQGFLKAMEEANIEVRDEWIVQGDFEPESGYKAMHQILSQKHRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFTPALTTIHQPKERLGEMAFTMLLDRIISKREESQVIEVHPKLIERRSVADGPFIDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.174 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPKSWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.203 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLVGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.086 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEIIEAVENSCFAKGYTLILGNAHNNLEKQRAYLSMMAQKRVDGLLVMCSEYPQPLLSTLEEYRHIPMVVMDWGEAKADFTDSVIDNAFQGGYLAGRYLIERGHRDIGVIPGQLERNTGVGRFSGFMKALEEAAIKVPENWIVQGDFEPESGYRAMQQILSQPQRPTAVFCGGDIMAMGAICAADEMGLRVPQDISIIGYDNVRNARFFSPALTTIHQPKETLGQTAFNMLLDRIVNKREESQTIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.191 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVSEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.165 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.165 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.175 kDa

MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDWGEAKADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFMKAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETAFNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.873 kDa

MATIKDVAKHAGVSTTTVSHVINKTRFVAENTKAAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQKAYLAMLAQKRVDGLLVMCSEYPEQLLGMLEDYRNIPMVVMDWGTARGDFTDSIIDNAFEGGYLAGRYLIERGHRDIGAIPGQLSRNTGGGRHQGFLKALEEANITLREEWVVQGDFEPESGYKAMHQILTQKHRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFSPALTTIHQPKERLGETAFAMLLDRIVSKREDPQTIEVHPKLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.839 kDa

MATIKDVAKHAGVSTTTVSHVINKTRFVAENTKAAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQKAYLAMLAQKRVDGLLVMCSEYPDQLLGMLEDYRNIPMVVMDWGTARGDFTDSIIDNAFEGGYLAGRYLIERGHRDIGAIPGQLARNTGGGRHQGFLKALEEANIPVREEWIVQGDFEPESGYKAMHQILTQKHRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFSPALTTIHQPKERLGETAFAMLLDRIVSKREDPQTIEVHPKLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.779 kDa

MATIKDVAKHAGVSTTTVSHVINKTRFVAENTKAAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQKAYLAMLAQKRVDGLLVMCSEYPDQLLGMLEDYRNIPMVVMDWGTARGDFTDSIIDNAFEGGYLAGRYLIERGHRDIGAIPGQLARNTGGGRHQGFLKALEEANIPVREEWIVQGDSEPESGYKAMHQILTQKHRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFSPALTTIHQPKERLGETAFAMLLDRIVSKREDPQTIEVHPKLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.839 kDa

MATIKDVAKHAGVSTTTVSHVINKTRFVAENTKAAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQKAYLAMLAQKRVDGLLVMCSEYPDQLLGMLEDYRNIPMVVMDWGTARGDFTDSIIDNAFEGGYLAGRYLIERGHRDIGAIPGQLARNTGGGRHQGFLKALEEANIPVREEWIVQGDFEPESGYKAMHQILTQKHRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFSPALTTIHQPKERLGETAFAMLLDRIVSKREDPQTIEVHPKLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.839 kDa

MATIKDVAKHAGVSTTTVSHVINKTRFVAENTKAAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQKAYLAMLAQKRVDGLLVMCSEYPDQLLGMLEDYRNIPMVVMDWGTARGDFTDSIIDNAFEGGYLAGRYLIERGHRDIGAIPGQLARNTGGGRHQGFLKALEEANIPVREEWIVQGDFEPESGYKAMHQILTQKHRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFSPALTTIHQPKERLGETAFAMLLDRIVSKREDPQTIEVHPKLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.839 kDa

MATIKDVAKHAGVSTTTVSHVINKTRFVAENTKAAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQKAYLAMLAQKRVDGLLVMCSEYPDQLLGMLEDYRNIPMVVMDWGTARGDFTDSIIDNAFEGGYLAGRYLIERGHRDIGAIPGQLARNTGGGRHQGFLKALEEANIPVREEWIVQGDFEPESGYKAMHQILTQKHRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFSPALTTIHQPKERLGETAFAMLLDRIVSKREDPQTIEVHPKLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.839 kDa

MATIKDVAKHAGVSTTTVSHVINKTRFVAENTKAAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQKAYLAMLAQKRVDGLLVMCSEYPDQLLGMLEDYRNIPMVVMDWGTARGDFTDSIIDNAFEGGYLAGRYLIERGHRDIGAIPGQLARNTGGGRHQGFLKALEEANIPVREEWIVQGDFEPESGYKAMHQILTQKHRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFSPALTTIHQPKERLGETAFAMLLDRIVSKREDPQTIEVHPKLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.839 kDa

MATIKDVAKHAGVSTTTVSHVINKTRFVAENTKAAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQKAYLAMLAQKRVDGLLVMCSEYPDQLLGMLEDYRNIPMVVMDWGTARGDFTDSIIDNAFEGGYLAGRYLIERGHRDIGAIPGQLARNTGGGRHQGFLKALEEANIPVREEWIVQGDFEPESGYKAMHQILTQKHRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFSPALTTIHQPKERLGETAFAMLLDRIVSKREDPQTIEVHPKLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.839 kDa

MATIKDVAKHAGVSTTTVSHVINKTRFVAENTKAAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQKAYLAMLAQKRVDGLLVMCSEYPDQLLGMLEDYRNIPMVVMDWGTARGDFTDSIIDNAFEGGYLAGRYLIERGHRDIGAIPGQLARNTGGGRHQGFLKALEEANIPVREEWIVQGDFEPESGYKAMHQILTQKHRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFSPALTTIHQPKERLGETAFAMLLDRIVSKREDPQTIEVHPKLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

341 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.839 kDa

MATIKDVAKHAGVSTTTVSHVINKTRFVAENTKAAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAPYFAEVIEAVENSCYSKGYTLILCNSHNNLDKQKAYLAMLAQKRVDGLLVMCSEYPDQLLGMLEDYRNIPMVVMDWGTARGDFTDSIIDNAFEGGYLAGRYLIERGHRDIGAIPGQLARNTGGGRHQGFLKALEEANIPVREEWIVQGDFEPESGYKAMHQILTQKHRPTAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRNARYFSPALTTIHQPKERLGETAFAMLLDRIVSKREDPQTIEVHPKLVERRSVADGPFRDYRR

purR

HTH-type transcriptional repressor PurR

340 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.767 kDa

MATIKDVAKLVGVSTTTVSHVINKTRFVAEDTTKAVWEAIASLNYSPSAVARSLKVNTTKSIGMIITTSEAPYFAEIVLAVEEYCYRQGYSLFLCNTQNDAEKVQNHLDMLIKKRVDGILVMCSEYTENSLALFNGTNVPMVVMDWGPNDGKSDRIIDHCLDGGYMATKHLIDNGHRDIAIIAGYLYKTTAKARYDGFVKAMTEAGLLIRKEWIFENDFQPEGGYESMNNLLNQDKLPTAVICGCDAMALGVISAITEKGLSVPQDISVIGYDNIHSSRFYAPPLTTIHQSKTRLGQMAIDTLLERIQQHNEQPSEPVTPKVLEFYPELVVRSSVRNLNQ

purR

HTH-type transcriptional repressor PurR

339 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.165 kDa

MATIKDVAKLAGVSTTTVSHVINKTRFVAEETSKTVWNAVQKLNYSPSAVARSLKINTTKSIGMIITTSEAPYFAEIVLAVEEHCYQQGYSLFLCNTQNEPEKIQNHLDMLIKKRVDGILVMCSEYTRNSLELFNATNIPMVVMDWGKAHEKNDRIIDNSFNGAYLATRHLIDNGHKDIGVISGYLTKTICSERLEGFIKAMKEANLPIREEWILEGDFEPESGFEQMNNLLRLDKLPTAIFCFSDTIALGVLSALSEKGIAVPQDISIIGYDNTHSSRFFSPPLTTIHQSKSRLGVKALNLLLERIKLGHKEYQPHTIEFHPELVLRHSVRNLNKSEE

purR

HTH-type transcriptional repressor PurR

337 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.056 kDa

MATIKDVAKLAAVSTTTVSHVINKTRFVAEATQKRVWEAVEELNYAPSAVARSLKCNTTRTIGMLVTQSFNPFFAEVMHGVENYCYKQGYTLFMCNTEGDLEKQKHYLRMLAEKRVDGLLVMCSDLNEQLLTLLEKNTELPMVIMDWGPDSPRTDKIIDNSEEGGYLATKHLIENGHTHIACITGQADKVTCKERVRGFERAHIDANLTFNPEWILEGDFECASASRAVDKILAIEENKRPTALFCFNDIMALAAISKIQQSGLRVPEDISVIGYDNIELSAYFSPPLTTIHQPKRRVGKTAVEILLERIKDKDHERRVFEMQPEVVTRSSVSNRLK

purR

HTH-type transcriptional repressor PurR

337 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.987 kDa

MATIKDVAKLAAVSTTTVSHVINKTRFVAEATQKRVWEAVEELNYAPSAVARSLKCNTTRTIGMLVTQSFNPFFAEVMHGVENYCYKQGYTLFMCNTEGDLEKQKHYLRMLAEKRVDGLLVMCSDLNEQLLTLLEKNTELPMVIMDWGPDSPRTDKIIDNSEEGGYLATKHLIENGHTHIACITGQADKVTCKERVRGFERAHADANLSFNPEWILEGDFECASASKAVDKILSIEESKRPTALFCFNDIMALAAISKIQQSGLRVPEDISVIGYDNIELSAYFSPPLTTIHQPKRRVGKTAVEILLERIKDKDHERRVFEMQPEVVTRSSVLNRLK

purR

HTH-type transcriptional repressor PurR

336 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.469 kDa

MATIKDVAKMAGVSTTTVSHVINKTRFVAKDTEEAVLSAIKQLNYSPSAVARSLKVNTTKSIGMIVTTSEAPYFAEIIHSVEEHCYRQGYSLFLCNTQNDPEKVKNHLEMLAKKRVDGLLVMCSEYTQDSLDLLSSFSTIPMVVMDWGPNANTDVIDDHSFDGGYLATKHLIECGHKKIGIICGELNKTTARTRYEGFEKAMEEAKLTINPSWVLEGAFEPEDGYECMNRLLTQEELPTALFCCNDVMALGAISALTEKGLRVPEDMSIIGYDDIHASRFYAPPLTTIHQSKLRLGRQAVNILLERITHKDEGVQQYSRIDITPELIIRKSVKSIL

purR

HTH-type transcriptional repressor PurR

336 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.515 kDa

MATIKDVAKMAGVSTTTVSHVINKTRFVAKDTEEAVLSAIKQLNYSPSAVARSLKVNTTKSIGMIVTTSEAPYFAEIIHSVEEHCYRQGYSLFLCNTQNDPEKVKNHLEMLAKKRVDGLLVMCSEYTQDSLDLLSSFSTIPMVVMDWGPNANTDVIDDHSFDGGYLATKHLIECGHKKIGIICGELNKTTARTRYEGFEKAMEEAKLTINPSWVLEGAFEPEDGYECMNRLLTQEELPTALFCCNDVMALGAISALTEKCLRVPEDMSIIGYDDIHASRFYAPPLTTIHQSKLRLGRQAVNILLERITHKDEGVQQYSRIDITPELIIRKSVKSIL

purR

HTH-type transcriptional repressor PurR

336 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.508 kDa

MATIKDVAKMAGVSTTTVSHVINKTRFVAKDTEEAVLSAIKQLNYSPSAVARSLKVNTTKSIGMIVTTSEAPYFAEIIHSVEEHCYRQGYSLFCVTHKMDPEKVKNHLEMLAKKRVDGLLVMCSEYTQDSLDLLSSFSTIPMVVMDWGPNANTDVIDDHSFDGGYLATKHLIECGHKKIGIICGELNKTTARTRYEGFEKAMEEAKLTINPSWVLEGAFEPEDGYECMNRLLTQEKLPTALFCCNDVMALGAISALTEKGLRVPEDMSIIGYDDIHASRFYAPPLTTIHQSKLRLGRQAINILLERITHKDEGVQQYSRIDITPELIIRKSVKSIL

purR

HTH-type transcriptional repressor PurR

336 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.469 kDa

MATIKDVAKMAGVSTTTVSHVINKTRFVAKDTEEAVLSAIKQLNYSPSAVARSLKVNTTKSIGMIVTTSEAPYFAEIIHSVEEHCYRQGYSLFLCNTQNDPEKVKNHLEMLAKKRVDGLLVMCSEYTQDSLDLLSSFSTIPMVVMDWGPNANTDVIDDHSFDGGYLATKHLIECGHKKIGIICGELNKTTARTRYEGFEKAMEEAKLTINPSWVLEGAFEPEDGYECMNRLLTQEELPTALFCCNDVMALGAISALTEKGLRVPEDMSIIGYDDIHASRFYAPPLTTIHQSKLRLGRQAVNILLERITHKDEGVQQYSRIDITPELIIRKSVKSIL

purR

HTH-type transcriptional repressor PurR

336 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.831 kDa

MATIKDVAKLAGVSTTTVSHVINKTRFVAEDTSKAVWDAIQQLNYSPSAVARSLKVNTTKSIGMIITTSEAPYFAEIVLAVEEHCYQQGYSLFLCNTQNEPEKIQNHLDMLIKKRVDGVLVMCSEYTRDSLELFNGTNIPMVVMDWGKADDHSDRILDNSFEGGYLATQHLIENGHKDIGVIAGHLSKTLSKERYEGFLKAMHEANLPVRQEWIYEGDFEPESGFEQMNNLLRLEKLPTAIFCFSDTIALGAISALSEKGLSVPSYMSIIGYDNIHSSRFYSPPLTTIHQSKSRLGVKALNILLERIKIDKTQYQPQTIEFHPELVLRRSVRNLNK

purR

HTH-type transcriptional repressor PurR

336 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.831 kDa

MATIKDVAKLAGVSTTTVSHVINKTRFVAEDTSKAVWDAIQQLNYSPSAVARSLKVNTTKSIGMIITTSEAPYFAEIVLAVEEHCYQQGYSLFLCNTQNEPEKIQNHLDMLIKKRVDGVLVMCSEYTRDSLELFNGTNIPMVVMDWGKADDHSDRILDNSFEGGYLATQHLIENGHKDIGVIAGHLSKTLSKERYEGFLKAMHEANLPVRQEWIYEGDFEPESGFEQMNNLLRLEKLPTAIFCFSDTIALGAISALSEKGLSVPSYMSIIGYDNIHSSRFYSPPLTTIHQSKSRLGVKALNILLERIKIDKTQYQPQTIEFHPELVLRRSVRNLNK

purR

HTH-type transcriptional repressor PurR

336 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.783 kDa

MATIKDVAKLAGVSTTTVSHVINKTRFVAEDTSKAVWDAIQQLNYSPSAVARSLKVNTTKSIGMIITTSEAPYFAEIVLAVEEHCYQQGYSLFLCNTQNEPEKIQNHLDMLIKKRVDGVLVMCSEYTRDSLELFNGTNIPMVVMDWGKADDHSDRILDNSFEGGYLATQHLIENGHKDIGVIAGHLSKTLSKERYEGFLKAMHEANLPVRQEWIYEGDFEPESGFEQMNNLLRLEKLPTAIFCFSDTIALGAISALSEKGLSVPSDMSIIGYDNIHSSRFYSPPLTTIHQSKSRLGVKALNILLERIKIDKTQYQPQTIEFHPELVLRRSVRNLNK

purR

HTH-type transcriptional repressor PurR

336 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.793 kDa

MATIKDVAKLAGVSTTTVSHVINETRHVAEETKKIVLNAIEQLHYSPSAVARSLKVNTTKSIGMIVTTSEAPYFAEIIHAVEDHCYRQGYSLFLCNTQNNPEKIKNHLEMLAKKRVDGILVMCSEYTADSLDLMKSFSDLPMVVMDWGPVNPNTDRILDNSFEGGYLAGKHLVDNGHKEIAYLSAELKKTTARKRYEGFLKALHEAGLEMNPDWLLEGSFEPEDGYECMNRLLAQEFRPTAIFCCNDVMALGAISAITEKGFRVPEDFSVIGYDNVHISRFSAPPLTTIHQSKARLGERALQLLFERIQDKTAKRETIEIHPELVIRKSVKNLNRH

purR

HTH-type transcriptional repressor PurR

336 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.002 kDa

MATIKDVARLAGVSTTTVSHVINKTRFVAETTQEKVMEAVKQLNYAPSAVARSLKCNTTRTIGMLVTQSTNLFFSEVIDGVESYCYRQGYTLILCNTGGIYEKQRDYIRMLAEKRVDGILVMCSDLTQELQDMLDAHKDIPKVVMDWGPETSHADKIIDNSEEGGYLATKYLTDRGHTEIACLSGHFVKAACQERIQGFRRAMAEAKLTVNEDWILEGNFECDTAVLAADKIIAMDKRPTAVFCFNDTMALGLMSRLQQKGIRIPEDMSVIGYDNIELAEYFSPPLTTVHQPKRRVGKNAFEILLERIKDKEHERRIFEMHPEIVERDTVKDLTKS

purR

HTH-type transcriptional repressor PurR

336 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.002 kDa

MATIKDVARLAGVSTTTVSHVINKTRFVAETTQEKVMEAVKQLNYAPSAVARSLKCNTTRTIGMLVTQSTNLFFSEVIDGVESYCYRQGYTLILCNTGGIYEKQRDYIRMLAEKRVDGILVMCSDLTQELQDMLDAHKDIPKVVMDWGPETSHADKIIDNSEEGGYLATKYLTDRGHTEIACLSGHFVKAACQERIQGFRRAMAEAKLTVNEDWILEGNFECDTAVLAADKIIAMDKRPTAVFCFNDTMALGLMSRLQQKGIRIPEDMSVIGYDNIELAEYFSPPLTTVHQPKRRVGKNAFEILLERIKDKEHERRIFEMHPEIVERDTVKDLTKS

purR

HTH-type transcriptional repressor PurR

336 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

38.002 kDa

MATIKDVARLAGVSTTTVSHVINKTRFVAETTQEKVMEAVKQLNYAPSAVARSLKCNTTRTIGMLVTQSTNLFFSEVIDGVESYCYRQGYTLILCNTGGIYEKQRDYIRMLAEKRVDGILVMCSDLTQELQDMLDAHKDIPKVVMDWGPETSHADKIIDNSEEGGYLATKYLTDRGHTEIACLSGHFVKAACQERIQGFRRAMAEAKLTVNEDWILEGNFECDTAVLAADKIIAMDKRPTAVFCFNDTMALGLMSRLQQKGIRIPEDMSVIGYDNIELAEYFSPPLTTVHQPKRRVGKNAFEILLERIKDKEHERRIFEMHPEIVERDTVKDLTKS

purR

HTH-type transcriptional repressor PurR

334 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.442 kDa

MATIKDVAKMAGVSTTTVSHVINKTRHVADETKQTVLDAIKALNYSPSAVARSLKVNTTKSIGMVVTTSETPYFAEIIHAVEEQCYRQGYSLFLCNTQNDPDKLKNHLEMLAKKRVDGVLVMCSEYKDDSRDLLKSFSYLPIVIMDWGPVNPDTDLILDNSFEGGYLAGKHLVDNGHKKIGYLSAELTKVTAKQRYQGFIKALSEANVEMKSEWLFEGSFEPEDGYECMNRLLALEDRPTAVFCCNDIMALGAISAITEKGYRVPDDFSVIGYDNVHSSRFFAPPLTTIHQSKARLGERALRLLFERIAHKDAKRETIEIHPELVIRKSVKKIA

purR

HTH-type transcriptional repressor PurR

334 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.244 kDa

MATIKDVAKMAGVSTTTVSHVINKTRFVAAETEKLVLQAIQELNYSPSAVARSLKVNTTKSIGMIVTSSEAPYFAEIIHAVEEHCYRQGYSLFLCNTQNNVEKIKNHLEMLIKKRVDGILVMCAEYTQDSLDLLANFTSLPLVVMDWGPDNKHTDIIQDHSFEGGYLATKYLIDHGHKDIGIIAGELTKTTAKTRYEGFIKAMNEAGLKINPDWVMEGFFEPEDGYECMNKILAQDTLPTAVFCCNDVMALGAISAIGEKGLRVPEDISIIGYDNIHASRFYSPPLTTIHQSKSRLGARAVTLLFERINEKSEERAVIEMHPELVIRKSVKSRL

purR

HTH-type transcriptional repressor PurR

334 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.246 kDa

MATIKDVARMAGVSTTTVSHVINKTRFVAEATQKKVLAAVDDLNYAPSAVARSLKCNTTKTIGMLVTKSTNPFFAEVIHGVEEYCYNAGYTLILCNTEGNLVKQRDYLRMLAEKRVDGLLVMCSDIDQDLLDLLARKSDLPMVIMDWGPESPLTDKIQDNAEQGGYVATKHFIDNGHEKIGCLSGHSEKSTCRERLKGFNKAMAEAGITVNNNWIIDGDFECESAVEAANQYIAMKDRPTAIFCFNDIMAMALISTFEQAGVRVPDDISVIGYDNIDLAPYFSPPLTTIHQPKRRLGKTAIEILMERVKDKNHERRVFEMNPELVIRKSVKDLN

purR

HTH-type transcriptional repressor PurR

334 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.54 kDa

MATIKDVARLAGVSTTTVSHVINKTRFVAETTQEKVMKAVDELNYAPSAVARSLKCNSTRTIGMLVTQSTNLFFSEVIDGVESYCYRQGYTLILCNTGGIYEKQRDYIRMLAEKRVDGILVMCSDLTEELKEMLDRHSDIPKVVMDWGPESSQADKIIDNSEEGGYIATKYLIDNGHTDIACLSGHFEKAACQERIAGYRRAMAEANLAVNEDWVLEGNFECDTAVLAADNITAMEKRPTAVFCFNDTMALGLMSRLQQNGLKVPDDISVIGYDNIELAEYFSPPLTTIHQPKRRVGKNAFEILLERIKDKEHEKRVFEMQPEIVVRNTVKKLN

purR

HTH-type transcriptional repressor PurR

334 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.674 kDa

MATIKDVARLAGVSTTTVSHVINKTRFVAEATQEKVMKAVDELNYAPSAVARSLKCNSTRTIGMLVTQSTNLFFSEVIDGVESYCYRQGYTLILCNTGGIYEKQRDYIRMLAEKRVDGILVMCSDLTEELKEMLDRHSDIPKVVMDWGPESSRADKIIDNSEEGGYLATKYLIDNGHTDIACLSGHFEKLACQERIAGFRRAMAEAKLPINEDWILEGNFECDTAVLVADKITAMEKRPTAVFCFNDTMALGLMSRLQQNGIKVPDDVSVIGYDNIELAEYFSPPLTTIHQPKRRVGKNAFEILLERIKDKEHEKRVFEMQPEIVIRNTVKKLN

purR

HTH-type transcriptional repressor PurR

334 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.612 kDa

MATIKDVARLAGVSTTTVSHVINKTRFVAEATQEKVNKAVDELNYAPSAVARSLKCNTTRTIGMLVTQSTNLFFSEVIDGVESYCYRQGYTLILCNTGGIYEKQRDYIRMLAEKRVDGILVMCSDLTEELREMLDRHADIPKVIMDWGPESSQADKIIDNSEEGGYLATKYLIERGHSKIACLSGHLDKAACVERISGYKRALNEAKITADENMIIEGNFECDTAVIAADQIIEMEERPTAVFCFNDTMALGLMSRLQEKGIRIPEDISVIGYDNIELAEYFSPPLTTVHQPKRRVGKNAFEILLERIKDKDHEKRVFEMHPEIVERSTVKTLN

purR

HTH-type transcriptional repressor PurR

334 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.756 kDa

MATIKDVARLAGVSTTTVSHVINKTRFVAEATQEKVMKAVDELNYAPSAVARSLKCNTTRTIGMLVTQSTNLFFSEVIDGVESYCYRQGYTLILCNTGGIYEKQRDYIRMLAEKRVDGILVMCSDLTEELREMLDKHADIPKVIMDWGPISSQADKIIDNSEEGGYLATKYLIDNGHTKIACLSGHFEKAACQERIQGFKRAMKEANITLNNEWILEGNFECDTAVMAADKIASWQDRPTAVFCFNDTMALGLMSRLQQLGLRIPEDISVIGYDNIELAEYFSPPLTTIHQPKRRVGKNAFEILLERIKDKEHDKRVFEMHPELVVRDTVKKIN

purR

HTH-type transcriptional repressor PurR

334 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.756 kDa

MATIKDVARLAGVSTTTVSHVINKTRFVAEATQEKVMKAVDELNYAPSAVARSLKCNTTRTIGMLVTQSTNLFFSEVIDGVESYCYRQGYTLILCNTGGIYEKQRDYIRMLAEKRVDGILVMCSDLTEELREMLDKHADIPKVIMDWGPISSQADKIIDNSEEGGYLATKYLIDNGHTKIACLSGHFEKAACQERIQGFKRAMKEANITLNNEWILEGNFECDTAVMAADKIASWQDRPTAVFCFNDTMALGLMSRLQQLGLRIPEDISVIGYDNIELAEYFSPPLTTIHQPKRRVGKNAFEILLERIKDKEHDKRVFEMHPELVVRDTVKKIN

purR

HTH-type transcriptional repressor PurR

333 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.247 kDa

MATIKDVAKMAGVSTTTVSHVINKTRFVAKETEQQVLQAIKNLNYSPSAVARSLKVNTTKSIGMIVTTCETPYFAEIIHSVEELCYRQGYSLFLCNTQNNPEKIKNHLDMLAKKRVDGLLVMCAEYTQNSLNLLATFEDLPMVVMDWGPFNENTDLIQDNSFSGGYIATKYLIDNGHKDIAIISGELKKTTAVMRYQGFEKAMQEANLAINPDWIMEGFFEPEDGYECMNKILVQDKLPTAVFCCNDVMALGAISAIGEKGLKVPDDISVIGYDNIHASRFFSPPLTTIHQSKSRLGVQAINLLFKRISEKGKEHEIIEIYPELVIRKSVKTL

purR

HTH-type transcriptional repressor PurR

333 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.247 kDa

MATIKDVAKMAGVSTTTVSHVINKTRFVAKETEQQVLQAIKNLNYSPSAVARSLKVNTTKSIGMIVTTCETPYFAEIIHSVEELCYRQGYSLFLCNTQNNPEKIKNHLDMLAKKRVDGLLVMCAEYTQNSLNLLAAFEDLPMVVMDWGPFNENTDLIQDNSFSGGYIATKYLIDNGHKDIAIISGELKKTTAVMRYQGFEKAMQEANLAINPDWIMEGFFEPEDGYECMNKILVQDKLPTAVFCCNDVMALGAISAIGEKSLKVPDDISVIGYDNIHASRFFSPPLTTIHQSKSRLGVQAINLLFKRISEKGKEHEIIEIYPELVIRKSVKTL

purR

HTH-type transcriptional repressor PurR

333 amino acids

Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression.

37.706 kDa

MATIKDVAKLASVSTTTVSHVINKTRFVAEATQKRVWEAVEELNYAPSAVARSLKCNTTRTIGMLVTQSFNPFFAEMMHGVENYCYKQGYTLFMCNTEGDLDKQKHYLRMLAEKRVDGLLVMCSDLNEQLLAQLEKNTELPMVIMDWGPDSPHTDKIIDNSEEGGYLATKHLIENGHTKIGCVTGQLDKATCKERIHGFYRALSEANLTSNPDWIFEGDFECSSASKSVEKMLQMEDKPTALFCFNDIMALAAISKIQQTGLRVPEDISIIGYDNIELSAYFSPPLTTIHQPKRRVGKTAVEILLERIKDKHHERRIFEMHPEVVTRKSVHKL

purR

Pur operon repressor

285 amino acids

Controls the transcription of the pur operon for purine biosynthetic genes, binds to the control region of the operon. DNA binding is inhibited by 5-phosphoribosyl 1-pyrophosphate.

Belongs to the purine/pyrimidine phosphoribosyltransferase family.

31.229 kDa

MKFRRSGRLVDLTNYLLTHPHELIPLTFFSERYESAKSSISEDLTIIKQTFEQQGIGTLLTVPGAAGGVKYIPKMKQAEAEEFVQTLGQSLANPERILPGGYVYLTDILGKPSVLSKVGKLFASVFAEREIDVVMTVATKGIPLAYAAASYLNVPVVIVRKDNKVTEGSTVSINYVSGSSNRIQTMSLAKRSMKTGSNVLIIDDFMKAGGTINGMINLLDEFNANVAGIGVLVEAEGVDERLVDEYMSLLTLSTINMKEKSIEIQNGNFLRFFKDNLLKNGETES

purR

Pur operon repressor

275 amino acids

Controls the transcription of the pur operon for purine biosynthetic genes.

Belongs to the purine/pyrimidine phosphoribosyltransferase family.

30.227 kDa

MKLRRSDRMVVISNYLINNPYKLTSLNTFAEKYESAKSSISEDIVIIKRAFEEIEIGHIQTVTGAGGGVIFTPSISSQDAKEMVEDLRTKLSESDRILPGGYIYLSDLLSTPAILKNIGRIIAKSFMDQKIDAVMTVATKGVPLANAVANVLNVSFVIVRRDLKITEGSTVSVNYVSGSSGDRIEKMFLSKRSLKAGSRVLIVDDFLKGGGTVNGMISLLREFDSELAGVAVFADNAQEEREKQFDYKSLLKVTNIDVKNQAIDVEVGNIFDEDK

purR

Pur operon repressor

275 amino acids

Controls the transcription of the pur operon for purine biosynthetic genes.

Belongs to the purine/pyrimidine phosphoribosyltransferase family.

30.227 kDa

MKLRRSDRMVVISNYLINNPYKLTSLNTFAEKYESAKSSISEDIVIIKRAFEEIEIGHIQTVTGAGGGVIFTPSISSQDAKEMVEDLRTKLSESDRILPGGYIYLSDLLSTPAILKNIGRIIAKSFMDQKIDAVMTVATKGVPLANAVANVLNVSFVIVRRDLKITEGSTVSVNYVSGSSGDRIEKMFLSKRSLKAGSRVLIVDDFLKGGGTVNGMISLLREFDSELAGVAVFADNAQEEREKQFDYKSLLKVTNIDVKNQAIDVEVGNIFDEDK

purR

Pur operon repressor

271 amino acids

Controls the transcription of the pur operon for purine biosynthetic genes.

Belongs to the purine/pyrimidine phosphoribosyltransferase family.

30.361 kDa

MKRNERLVDFTNFLINHPNQMLNLNELSKHYEVAKSSISEDLVFIKRVFENQGVGLVETFPGSLGGVRFTPYITDERSLEMSQEIAELLREENRILPGGYIYLSDILGTPSNLRKIGQIIAHEYHEKQVDVVMTIATKGIPIAQSVAEILDVPFVIVRRDPKVTEGATLNVNYMSGSSSRVENMTLSKRSLSIGQNVLIVDDFMKGAGTINGMRSLVHEFDCLLAGVAVFLEGPFKGERLIDDYKSILKVDRIDIANRSIDVQLGNIFNDK

purR

Pur operon repressor

271 amino acids

Controls the transcription of the pur operon for purine biosynthetic genes.

Belongs to the purine/pyrimidine phosphoribosyltransferase family.

30.361 kDa

MKRNERLVDFTNFLINHPNQMLNLNELSKHYEVAKSSISEDLVFIKRVFENQGVGLVETFPGSLGGVRFTPYITDERSLEMSQEIAELLREENRILPGGYIYLSDILGTPSNLRKIGQIIAHEYHEKQVDVVMTIATKGIPIAQSVAEILDVPFVIVRRDPKVTEGATLNVNYMSGSSSRVENMTLSKRSLSIGQNVLIVDDFMKGAGTINGMRSLVHEFDCLLAGVAVFLEGPFKGERLIDDYKSILKVDRIDIANRSIDVQLGNIFNDK