purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

272 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

30.615 kDa

MIKVVPKVLVMSGYGINCETETAHTFQKAGAKTDIVHINDLIAGKKKMADYEIIMFPGGFSYGDDTGSGNAFANKIKNNLFDDLKEFINSGKLILGICNGFQVMTNLGLFALPSTDYGERISALEANTNNRYECRWVHIKENESICVFTKGIDIIHVPIAHGEGRFYCDEKTYLELKENKQIVFTYCDSEGNPANKEYPLNPNGAYYDIAGICDKSGRIMGLMPHPERSLYSISEPEYQLKKEIAKRNGEIIPEFIESNIQIFKNAVEYFNK

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

272 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

30.466 kDa

MIKVVPKVLVMSGYGINCETETAHAFQKAGAETDIVHINDLIAGKKKMADYEIIMFPGGFSYGDDTGSGNAFANKIKNNLFDDLTEFINSGKLILGICNGFQVMTNLGLFALPSTDYGERISALESNTNNRYECRWVHIKENDSVCVFTKGINVTHVPIAHGEGRFYCDEKTYHELKENKQIVFSYCDSEGNPANGEYPLNPNGAYQDIAGICDKTGRIFGLMPHPERSLYSISEPEYQLKKEIAKRNGDIIPEFIENNLQIFKNAVEYFNK

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

271 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

30.786 kDa

MDREEIKVAVLRMEGTNCEDETVKAFRSLGVEAEAVHIKQFYSDMIRFEEQRSVFDYQCLVFPGGFSAGDYIRAGAIFSARVKSVLRKDIEEFIKMGYPILGICNGFQVLVELGALPGFDEDKPLAEKPEMALAMNDSSRFECRPTLLKKESEKCIFVKNLKKDVVMFPVAHAEGKVVFPSGKEDEYLERLTSNDQIVFRYVDEKGDYAGYPWNPNGSFYNIAGICNATHTVFGLMPHPERAFFGYQVGRREGYGDGYCIFRSVVDYLEKL

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

270 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

29.748 kDa

MKPRALVLHATGTNRDGDAARALELAGAEPEIVHINKLKAKEKNWKDYEILVIPGGFSYADALGAGKLFALDLSNYFFDEVSEFVAAGKPVIGICNGFQVLVKSGILPGKEKDGKVILDKDGYKNRQATLTYNKQGRFECRFTTMIPQKSNCIWTKDLKGNIHCPIAHGEGRFLTDSQKTLDDLFEKGQIALVYGGKDAEKSIPANGEYPFNPNGSLADIAGICNTKGNVLGLMPHPENNVVIRERDSEEEKERTKLCLDMWKAGVNYVL

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

269 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

30.314 kDa

MVPKVLVMSGYGINCETETAHAFQKAGAETDIVHINDLIAGKKKMADYEIIMFPGGFSYGDDTGSGNAFANKIKNNLFDDLKEFINSGKLILGICNGFQVMTNLGLFALPSTDYGERISALEANTNNRYECRWVHVKENDSICVFTKGITITHVPIAHGEGRFYCDEKTYFELKENKQIVFSYCDSEGNSANQEYPLNPNGAYYDIAGICDKTGRIMGLMPHPERSLYSISEPEYQLKKEIAKRNREIIPEFIESNLQIFKNAVEYFNK

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

262 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

29.483 kDa

MRIAVIQFPGTNCEHETLVAVRECGMDGEIFRWNRPEQELCEFDGYVIPGGFSYQDRVRAGVIASKEPVMATLREEAANGKPIIGICNGFQILVESGILPFGDGVRLALAQNVMIRGGEIVRRGYYCAWTMLRHDAEEKRCSGSYILRRGEILSIPIAHAEGNLVASDRKVIERLIEDDQIVFRYCSPQGEIINEFPVNVNGSTENIAGISNPEGNVLGMMPHPERAFFAWQLPRKHPRIPGYGPGRKIFDSMKRYIEERRS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

258 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

29.034 kDa

MKQSPKIGILLMEGTNNETEVYYSVKRSGGSPDFIHINDLSAGRKRVSDYDGLIIPGGFSAGDYIRAGVIFAARLGAVAGKEIREFVDDGKPLIGICNGFQVLMEMGLIYDRSKITLTNNESNRFECRYTYMKMTSRNRIFQSGFYGKGVFQVPVAHAEGRIAVSERSVLKKLYENDQVVFKYSNENDVTDEYPWNPNGSIDSVASLSNEAGNVIGLMPHPERIYYRYQAMYLETEKDEVAGKIFYDSLVNYARDRNG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

257 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

28.314 kDa

MKPPKVGILLMEGTNNETEVFFSVRRSGGDPDYVHVSDIAAGRKAISDYDALIVPGGFSAGDYIRAGVIFAARLLAVAGKEIRDFVDSGRPLIGICNGFQVIMEMGLIGKRDELTLTNNESGRFECRYTYITMTSDNPIFRDAFKGKGSFQVPVAHAEGRIAVSGVSVLKRLYENDQVLFKYSDTHGVTDEYPWNPNGSVDSIASLTNEHGNVIGLMPHPERIYYSYQAMYDDARKDQATGKLFYDSLISYLSGVHG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

255 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

27.972 kDa

MSKVKTLILRTPGTNCDIETSYAFELAGSETEMVHINELLAKPSRLAEFQIMAFPGGFGYGDDLGAGRVLANEVRLKLGEKINRFHESGGLIIGICNGFQALVKTGILPGPMKDGQKITLTENNSGRFECRWTYLAVNPFSTCVFTQGIDRLYLPVAHGEGKLLGSPEVINKLNSVVYYTDKDGKRNSPYPANPAGTLMDIAGIADESGRIFALMPHPERFVRGSQHPRWPAEGLKEEGDGLKIFTNAVKWARQV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

252 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

27.101 kDa

MADLNVGVVVFPGSNCDHDTEYAVASFSGVKPVMLWHNEHDLKGCDAIILPGGFSYGDYLRCGSIARFSPIMREVIDFAGQGRPVLGICNGFQVLVESGLLEGALIRNAGRKFICRQSTISVVNNSTIFTDRYEKGEVLRVPVAHGEGNYYASVETIDSLESNGQVVFRYTDAEGNATAEANFNGSLNNIAGITNKQGNVLGLMPHPERASEELLGSGDGRRVFESLFAHLAGTKRSSRGCCSTSPTRRSAS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

248 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

28.271 kDa

MDSKRAMVLRMEGTNNEEEAFLSLKRAGFEPEYVHINDLARKRKFIDDYNLMFIPGGFSAGDYIRAGAIFAARLRPFLSDINKFIDSGRFIIGVCNGFQVLTELGLFFNGDRKIALTVNESNRFECRFTYIRLSTKKVLSGLGNRPFQVPVAHLEGRVYCDNKTLDELIENDQIIFRYVDNNGNYSGYPWNPNGSIMNIAGITNDSGNVIGMMPHPERVYYPYQMSGNERNSDKGTGEIFFRILYNST

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

241 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

26.313 kDa

MSEGLNVGIVVFPGSNCDRDVAYVTREILQWPTQLLWHEETDLGDYDLIVLPGGFSFGDYLRCGAIARFSPIMAAVKDHAAAGKWVLGICNGFQILTEAKLLPGALVRNRDLHFICDRVHLRLEAKERPWLRAYGDKTVIRLPIAHGEGCYYADATTLAELEANRQVLFRYADAQGNVTPESNPNGSLNNIAGICNAAGNVLGMMPHPERAADPALSHSPSEHTLDGLQLFQSLLLASAFA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

236 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.465 kDa

MRFAVVTFPGSNGDHDALMAIRLGLGHAAELVWYTETDLSRFDCIIIPGGFSYGDYLRAGALARFAPVMSAVAREAEAGKPILGICNGFQILTEARLLPGALLRNASLEFVCDWVWVRVEQTRTPWTSQLAPGTLLRLPIAHGEGRYYVEAEELVALETNGQVVFRYVDADGLPTADANPNGSVANIAGVCNERGNVVGLMPHPERAYDRFVGGDDGLRILASVLSVGLEVAHSPR

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

236 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.444 kDa

MKFGVIVFPGSNCDQDVHYALGSVLGQNVDYLWHGDTSVSGYDCLILPGGFSYGDYLRAGAIARFAPIMPAVIDFARSGGLVLGICNGFQILLEAGLLPGAMMRNACLQFRCQWTCLKVDNNATPFTNRFREGQVVRIPIAHGEGNYYADAATLAQLEANRQIIFRYCSPDGEVTPAANPNGSVGNIAGIINREGNVLGMMPHPERCAEGILGGSDGRELLASIVDWWERGERLGA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

235 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.719 kDa

MKFGVLVFPGSNCDRDVVLVTRDLLKQPTRMVWHQETDISDLDVVVIPGGFSYGDYLRCGAISRFSPAMQATMAHAEQGKLVLGICNGFQVLTESGLLPGALVRNRDLHFICDRVPVRVERTNLPWTQAYQAGQVITLPIAHGEGCYYADPETLKQLQANQQILFRYCQPNGEITPDSNPNGSVENIAGICNRQGNVVGMMPHPERASDPTLGYTDGLLLFQGVLNSLMAQGVTA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

235 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.288 kDa

MRFGILVFPGTNCEMETFYVLREVVGVQADYVWHEARDLTPYDAVVIPGGFTYGDRVRSGALACRAPVMEAVAEFAARGGLVLGICNGFQILTEAGLLPGGFRPNAHGRYRCGWSRVRVENAATPFTLACRPGQVLKIPVSHGMGNYQADPDTLRALSENQQVLFRYCTPEGAVTPGANPNGSAENIAGIVNRTGNVAGVMPHPERATEQVLGSADGRLLFASMVQHLTGRVIRV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

235 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.198 kDa

MSARFGVVVFPGSNCDHDAYHAAHDVFDQEARFIWHEEASLGDVDVVIVPGGFSYGDYLRSGAVARFSPIMQDVVRFAEDGGLVFGICNGFQVLCEAGLLPGTLMRNESLRFVCKDTPLRVENAGTPFTNALTEGQVITIPVSHGEGRYYADEDVLARIEANDQVLLRYSTADGAVTDEANPNGSVHGIAGLVNEAGNVCGLMPHPERCVESLLGGDDGRLIFESLLNHVSIVAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

234 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.793 kDa

MKFGVVVFPGSNCDADCFHVLKNVFGRETVYIWHKEDNFDVDCIVLPGGFSYGDYLRAGAIARFSPVMKKVVEFANAGGLVIGICNGFQILLEAGLLPGAMLRNKSINFRCHDVYLRVENNNTPFTSKAHEGQVLKIPIAHGEGNYYCEPDTLKKLIANGQVVFRYCNSRGEVTEDANPNGSLYNIAGIINEKGNVLGMMPHPERCSENILGGEDGRVIWESIIAYLERGANRG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

234 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.225 kDa

MSAITVGVVVFPGSNCDHDTAYALASFAGVKPVMLWHNNHDLQGAQAIVLPGGFSYGDYLRAGAIARFSPLMKEVVEFARKGYPVLGICNGFQVLLESGLLEGALSRNRDKKFLCCQTTITPVNCSTRFTEDYHQGEVLRIPIAHGEGNYFAPPEVLESLQEHNQIAFQYCNAQGEVTVEANPNGSLLNIAGIVNRAGNVLGLMPHPERASDAALGSVDGRLLFESLFRSLTGV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

234 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.269 kDa

MADVTVGIVVFPGSNCDHDTEYAVASFPGVKPVMLWHNDHDLKGCDAVILPGGFSYGDYLRCGAIARFSPIMREVIDFAGKGRPVLGICNGFQVLVECGLLEGALIRNAGRRFVSRQTTISVANNATIFTDRYQKGEVLRVPVAHGEGNYYASPETIESLESNGQVVFRYTDAWGNATAEANFNGSMNNIAGIVNKQGNVLGLMPHPERASEKLLGSEDGRRLFESLFAHLAGA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

234 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.255 kDa

MTARIGVVTFPGSLDDRDTQRAIKLAGAEPVALWHKDKDLKQVDAVVLPGGFSYGDYLRAGAISRFSPVMETVIEQAKSGMPVLGICNGFQILTEAHLLPGAMLGNNHLHFICRDQKLRVENADTAWTSDYEAGQEIHIPLKNMDGRYVADERTLDMLEAEGRVAFRYVVGGAAADGYGNPNGSLRDIAGITNEAGNVVGLMPHPEHAVEPLIGTGRTDGLPFFTSILKKLVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

234 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

26.306 kDa

MKAAVVVFPGSNCDKDTFYVLKYVMGFDCYYVFHKDHFYEKEFDLIVLPGGFSYGDYLRAGAIARFSPVMRSVSKAAENGVLIVGICNGFQILTEAGLLPGVLMKNKDLRFHCHDVYLRVDNNKTPFTLAYSEGEVIKMNIAHGEGNYYFDHCKEIEDKIVLRYCDRNGNITEDSNPNGSVLNIAGIVSKNGNVFGLMPHPERCSEKLLGSDNGKKIFESVALYLERRKDHAFA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

233 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.121 kDa

MTEADSPARIGIVTFPGSLDDQDTALAVRAAGAEPVSLWHGDSDLAGVDAVILPGGFSYGDYLRAGAIARFSPMVAALVPAARAGLPILGICNGFQVLCEAGLLPGALTRNVGLHFVCRDQRLRVEAPGTAWTRGYQDGEEIVIPVKHGDGRYVAAPDVLAELEAAGRVVVRYVGGNPNGSAADIAGICNESRTIVGLMPHPEHAVDDLTGPGVDGLRMFTSVLSGFLSAFSS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

233 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.702 kDa

MKAAIVVFPGTNRERDMVHALKLVTGQAPRLIWHGETSLGDLDLVVLPGGFSFGDYLRSGAVAAHSPIMRDVKAFAGKGGHVLGVCNGFQILTESHLLPGALLRNAGLRFLSQDCHLKVENASSPYTQGWTRGDVFRAPLAHGDGNYTASPETLKRLEGEGRVAFRYCGADGAVSDDDRTTNPNGSTRSIAGILSENGRVCGLMPHPENLTDPEIGATDGVPLFKGLVEALVG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

233 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.053 kDa

MKSAILVFPGINRERDMARALKLISGHEPAMVWHAETSLPKGTDLVVMPGGFSYGDYLRCGAIAARSPVMDAVRAFAADGGLVLGVCNGFQILCESGLLPGILMRNARLKFICHDVHLRVERSDTPFTRGYNAGQVIRVPVAHGEGNYAADEETIRRLEGEGRVLYRYCSATGEIGDTHNINGAAQSIAGIVNVRGNVLGMMPHPENHVEDIMGCTDGRGLFAGLVAHLERAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

233 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25 kDa

MKSAVLVFPGINRERDMARALRLVSGREPAMVWHAETSLPEGTDLVVAPGGFSYGDYLRCGAIAARAPVMDAVRAFASDGGLVLGVCNGFQILCESGLLPGILMRNARLKFICHDVHLRVERSDTPFTRGYNAGQVIRVPVAHGEGNYAADEDTIRRLEGEGRVLYRYCSASGEVGDTHNINGAAQSIAGIVNERGNVLGMMPHPENHVEDIMGCTDGRGLFAGLVAHLERAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

233 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.975 kDa

MKSAVLVFPGINRERDMARALKLVSGHDAAMVWHADTELPNGTDLVVVPGGFSYGDYLRCGAIAARAPVMDAVRKFASDGGLVLGVCNGFQILCESGLLPGVLMRNARLKFICRDVHLRVERNDSPFTRGYAAGQVIKVPVAHGEGNYEADEETVKRLEGDGRVLYRYCSPEGEIGESHNINGAAASIAGIVSERGNVLGMMPHPENHVEDIMGCTDGRGLFAGLVEHLKTAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

233 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.92 kDa

MKSAVLVFPGINRERDMARALKLVSGNDAAMVWHAETELPKGTDLVVVPGGFSYGDYLRCGAIAARAPVMDAVRKFAADGGLVLGVCNGFQILCESGLLPGVLMRNARLKFICRDVHLRVERNDTPFTQGYKAGQVIKVPVAHGEGNYEADEDTVKRLEGDGRVLYRYCSPEGEVGESHNINGAAASIAGIVSERGNVLGMMPHPENHVEDIMGCTDGRGLFAGLAQHLAKAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

233 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.933 kDa

MKAAILVFPGINRDRDMARALRLISGSEPAMVWHAETSLPAGTDLVVVPGGFSYGDYLRCGAIAARAPVMDAVRDYAAKGGLVLGVCNGFQILCESGLLPGVLMRNAQLKFICRDVHLRVERSDTPFTRGYNAGQVIRVPVAHGEGNYEADEETIQRLEGEGRVLYRYCSAEGVVDEAANINGAAHSIAGIVNDKGNVLGMMPHPENHVEDIMGCTDGRGLFAGLAQHLEKAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

233 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.845 kDa

MKSAILVFPGINRERDMARALQLASGSEPAMVWHADTELPKGTDLVVVPGGFSYGDYLRCGAIAARAPVMDAVRKFASDGGLVLGVCNGFQILCESGLLPGVLMRNARLKFICHDVHLRVERSDTPFTRGYNAGQVIRVPVAHGEGNYEADEETLQRLEGDGRVLYRYCSASGEVGEAHNINGAAASIAGIVSERGNVLGMMPHPENHVEAIMGCTDGRGLFAGLVEHLAKAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

232 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.255 kDa

MKFAVIVFPGSNCDRDVVTVTRGLLDQPTRLVWHTEDDLDGCDVAVIPGGFSYGDYLRCGAIARFSPVMQAVRRHAERGGLVIGICNGFQVLTEAGLLPGALVRNRDLQFVCDRVALKVERTDLPWVHSYRPGEVITLPIAHGEGCYYAEEATLAELEENRQVVFRYCRPDGTIDAVGNPNGSLHNIAGLCNRHGNVLGMMPHPERASDPILGGSDGRRLFESLVASALAVV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

232 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.664 kDa

MRIGVITFPGSLDDRDALRAIRLAGAEPVALWHGDHDLQGVDALVLPGGFSYGDYLRCGAIASLSPIMSEVVEAAGKGMPVLGICNGFQMLAEAILVPGGLIRNDHGNFICHAQRLTVENAETPWTGGFERGQKIVIPLKNGEGSFIASAEELKRLEGEGMVVFRYRGVNPNGSLNDIAGVRNERGNVVGLMPHPEHAVEPGFGPDTDQAMRSGTDGLAFFTSVVRSTLVEA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

232 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.588 kDa

MKIAIIQFGGTNCDMDVLHVLKDVVGVDAETVWYKEENLTGFDGVVVPGGFSYGDYLRAGAIAARTPIMDSVKKIAAEGKPVLGICNGFQVLTEARLLAGALTTNEYPKFRCHWTNLRVETADTPFTSKFRKGEVIRMPIAHMEGKFYAEESTLAELDENEQVVFRYVDEKGRVTDEANPNGSLENIAGILNASRNILGLMPHPERASESILGSDDGRKVFESMADYITENF

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

232 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.732 kDa

MKIAILQFGGTNCDQDVLHVLKDVVGVDAETVWYKQEDLTGFDGVVVPGGFSYGDYLRAGAIAARTPIMNSVKKLAAEGKPVLGICNGFQILTEARVLEGALTTNEYPKFRCHWTNLRVETVDTPFTSKFRKGEVIRMPIAHMEGQFYAEEKTLAELDENEQVVFRYVDENGKVTDEANPNGSLENIAGIVNTSRNIFGLMPHPERASESILGSDDGLRVFESMVDYITENF

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

232 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.615 kDa

MKIAIIQFGGTNCDMDVLHVLKDVVGVDAETVWYKEESLTGFDGVVVPGGFSYGDYLRAGAIAARTPIMDSIKKIASEGKPVLGICNGFQILTEARLLEGALTTNEYPKFRCHWTNLRVETANTPFTSKFRKGEVIKLPIAHMEGKFYAEEATLAELDENEQVVFRYVDEKGRLTDKANPNGSLENIAGIVNSSRNVLGLMPHPERASESILGSDEGRKVFESMADYITENF

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

231 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.254 kDa

MKFGVLIFPGSNCDHDAHWVLGQVAKQPVTFLWHESHDLENCDAIVVPGGFAYGDYLRTGAIAKFSPVMEAVRKFADKGGLVIGICNGFQILTESGLLPGALLRNEGLKYICKPVNIRVETTDAPFTQGLKKGEVLQVPIGHMEGNYVCDDATLAELKKQDRIVFRYATPDGQITREANPNGSIENIAGICNEGRNVLGMMPHPERASENELGMTDGFRIFESMVGAMAKR

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

231 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.172 kDa

MADITIGVVVFPGSNCDHDTMHAVASFEGVKPVMLWHGSHDLQGAKAIILPGGFSYGDYLRAGSIARFSPIMQEVVDAAGKGLPVLGICNGFQVLLESGLLDGALSRNRDKKFLCRDTYIRPVNSNTMFTGLYREDEVLSIPIAHGEGNYFAPPEVIESLEEHDQVVFRYTDREGHVSDEANPNGSVGNIAGIMNRNGNVLGLMPHPERASEKLLGSEDGRRLFASLFRQL

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

230 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.417 kDa

MKIAVTKFLGTNCDLDVCHAVKLAGGEPELVFFTQENLDSYKGAVIPGGFSYGDYLRAGAISARTPIIKGLKKMVEEGKPVLGICNGAQIGLEAGFSKGTLTNNLNAKFICKWVYIRVENNKTPFTQYYKKGEVLKIPIAHAEGRFYADDETLDYMYKNNMIVFKYCDETGEVTEEANPNGSIDNIAGVCNENQNCVLLMPHPERASEKILGSDDGLKMFKGMIDYAKRI

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

230 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.563 kDa

MRVAVIVFPGSNADVDLFNAVEDVMGVPVDYVWHSDTDLSKYDAILLPGGFSYGDYLRCGAVARFSPVMEQVVKAADEGKLIMGICNGFQILTEVGLLPGALLRNRSLKFRCKLSELRVENNDTSFTRDFAAGEVIQIPIAHGEGNYYCDEETLAKLKANKQIVFRYHGENPNGSLEDIAGICNERGNVLGMMPHPERAVHSWMTSDDGRRMFTSILKTWREQNSVTTHA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

230 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.374 kDa

MNSAIIVFPGTNRERDMAKALTLVGGKAPQMVWHRDSALPAGLDLVVLPGGFSYGDYLRSGAMGARSPILDAVRRFAEAGGHVLGVCNGFQILTEAGLLPGALMRNRDLRFICRDVHLRVETIASPYTSAYGLGEVARVPVAHHDGNYFADDATLAQLADEDRVAFRYCAADGTVGEASTPNGSRDAIAGILSANRRVLGMMPHPENLVEPALGGIGGRALFQSIVESLS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

228 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.209 kDa

MKFAVVVFPGSNCDVDMYHAIADELGEEVEYVWHDEDNLDRFDAVLLPGGFSYGDYLRSGAIARFSKVMAAVKKAAEAGKPVLGVCNGFQILLEAGLLPGAMRRNQGLKFICRPVQLTVENHETMFTSAYEKGEVITIPIAHGEGNYYCDEQTLERLVENRQIVFRYHGENPNGSLADIAGIVNEQGNVLGMMPHPERAVDALLGSADGLKLFRSIVNYWRETHVVTA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

228 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.345 kDa

MKFAVIVFPGSNCDVDMYHAIADELGEEVEYVWHDAENLDRFDAILLPGGFSYGDYLRSGAIARFSNVMKAVKKAADEGKPVLGVCNGFQILLEAGLLPGAMRRNNSLKFICRPVSLRVENNETMFTSAYKQGEVITIPIAHGEGNYYCDEQTLKRLIENRQIVFRYHGENPNGSLDDIAGIVNEKGNVLGMMPHPERAVDSLLGSADGLKLFQSIVKYWRETHVVTA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

228 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.225 kDa

MKFAVIVFPGSNCDVDMYHAIADELGEEVEYVWHDEENLDRFDAILLPGGFSYGDYLRSGAIARFSKVMAAVKQAAEAGKPVLGVCNGFQILLEAGLLPGAMRRNQGLKFICRPVQLVVENNETMFTSAYGKDEVITIPIAHGEGNYYCDEQTLNRLVENRQIVFRYHGENPNGSLADIAGIVNERGNVLGMMPHPERAVDALLGSADGLKLFRSIVNYWRETHVVTA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

228 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.378 kDa

MTVVVVQFGGSNCDRDAVRALQHIGIDATRVWHEDGLNDSVENLDGIILPGGFSYGDYLRAGAMAAHSPIVNDIQAAAERGIPVLGVCNGAQVGCESGLTPGAFTTNDRARFQCETVHLRVENATTPWTEAYEAGTVIEIPIAHGEGRFEITENEYEMLKNDNQILFRYCDASGNITDDANPNGSRGNVAGITGNYDTVAVLMPHPERATLPELGRSTDGKGILQAFG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

228 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.192 kDa

MKAAVISFPGSNCDLDLQWAVRDIAGAECDLIKPTQTDLTAYDVVMVPGGFSYGDYLRSGAIARFSPVMDALKQFAAAGGYVIGICNGFQILTEAGFLPGALQWNRDLNFICEPVALTVENAGTAFSNQYQVGDHLTLPIAHGEGNYYADPETLAALETNGQVVFRYANNPNGSMHDIAGVTNETGNVLGMMPHPERAVEALLGGTDGLGVFQSLINQTEGADVRGAR

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

228 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.084 kDa

MKAAVISFPGSNCDLDLQWAVRAIAGAECDLIKPTQTDLTAYDVVMVPGGFSYGDYLRSGAIARFSPVMAALKQFAAAGGYVIGICNGFQILTEAGLLPGALQWNRDLNFICEPVALTVENAGTAFSNQYQVGEHLTLPIAHGEGNYYADPETLAALETNGQVVFRYANNPNGSMHDIAGVTNETGNVLGMMPHPERAVEALLGGTDGLGVFQSLINQTEGADVRGAR

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

228 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.12 kDa

MKFAVLVFPGSNCDADLYHAIVDVCHEEAAYVSYTATSLAGFDAVLIPGGFSYDDYLRSGAIAKLAPIMTAVVAFAKAGKPVLGICNGFQILTEAGLLPGALLPNRQTHFICETVTLQVENNDTRFTNQYAKGATIALPIAHGEGNYYCDPETLAQLHANHQIAFTYTTDVNGSLDNIAGITNEAGNVLGMMPHPERAVEVLLGSADGLGVFQSILTTLKSGVVTHGE

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

228 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.325 kDa

MKFAVVVFPGSNCDVDMYHAISDELGEEVEYVWHDVDCLDDFDAILLPGGFSYGDYLRSGAIARFSNVMKAIKKAADEGKPILGVCNGFQILLEAGLLPGAMRRNNTLTFICRPIKLRVENNETMFTSQYEQGEVITIPIAHGEGNYYCDEQTLQQLIANNQIVFRYEGENPNGSLFNIAGIVNEKGNVLGMMPHPERAVHELLGGADGLKLFQSIVTYWRDAHVVTT

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

228 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.303 kDa

MKFAVIVFPGSNCDRDMYHAVKEVAGAEAELVWYTETDKLEGVDGILLPGGFSYGDYLRSGSMASTSDVMHKIREHAAKGKPVLGVCNGFQILTESGLLPGALMRNKHLSFMCHQEELVVEDNQTFFTSLYEKKEVVRFPIAHGEGSYFCDEATLKELQANNQIVFTYKNNPNGSIENIAGIRNKQGNVLGMMPHPERAVEELLGSDDGLKLFKSMIANWRDSYAINA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.742 kDa

MKFAVIVFPGSNCDLDMYHAVKDALGEEVEYVFHTETSLEGYDGVLLPGGFSYGDYLRCGAIAQFSPIMEEVKRFAAEGKTVLGVCNGFQILVEAGLLPGVLHRNTGLKFMCRTVELKVENNETRFTSDYAAQETITIPIAHGEGNYYCDDATYAMLQTNRQIAFTYTDNPNGSRGDIAGITNKAGNVLGMMPHPERAVELLTGGTDGLKLFTSLVKQGAHHVKTTV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.885 kDa

MKFAVIQFPGSNCDLDMLHAIRDSLGEEAEYVWHAETSLAGFDAVLLPGGFSYGDYLRTGAIAKFSSIMPEVLRFAEMGKPVLGVCNGFQILTEIGLLPGALIRNNNLHFICKTVPLRVANADTMFTGLYEEGEIIQVPVAHGEGNYYCDDETLLKLKDNNQIVFTYDSVNPNGSRADIAGIVNERGNVLGMMPHPERAVEDIIGGTDGLRLFESVVKAWKEEQVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.87 kDa

MKFAVIQFPGSNCDLDMLHAIRDSLGEEAEYVWHAETSLAGFDAVLLPGGFSYGDYLRTGAIAKFSSIMPEVLRFAEMGKPVLGVCNGFQILTEIGLLPGALIRNNNLHFICKTVPLRVANASTMFTGLYKEGEIIQVPVAHGEGNYYCDDETLLKLKDNNQIVFTYDSVNPNGSRADIAGIVNERGNVLGMMPHPERAVEEIIGGTDGLRLFESVVKAWKEEQVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.87 kDa

MKFAVIQFPGSNCDLDMLHAIRDSLGEEAEYVWHAETSLAGFDAVLLPGGFSYGDYLRTGAIAKFSSIMPEVLRFAEMGKPVLGVCNGFQILTEIGLLPGALIRNNNLHFICKTVPLRVANASTMFTGLYKEGEIIQVPVAHGEGNYYCDDETLLKLKDNNQIVFTYDSVNPNGSRADIAGIVNERGNVLGMMPHPERAVEEIIGGTDGLRLFESVVKAWKEEQVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.957 kDa

MKFAVIQFPGSNCDLDMLHAIRDSIGEEAEYVWHAETSLAGFDAVLLPGGFSYGDYLRTGAIAKFSSIMPEVLRFAEMGKPVLGVCNGFQILTEIGLLPGALIRNNNLHFICKTVPLRVANASTMFTELYEEGEIIQVPVAHGEGNYYCDDETLLKLKENNQIVFTYDSVNPNGSRADIAGIVNERGNVLGMMPHPERAVEEIIGGTDGLRLFESVVKAWKEEQVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.971 kDa

MKFAVIQFPGSNCDLDMLHAIRDSLGEEAEYIWHAETSLAGFDAVLLPGGFSYGDYLRTGAIAKFSSIMPEVLRFAEMGKPVLGVCNGFQILTEIGLLPGALIRNNNLHFICKTVPLRVANASTMFTELYEEGEIIQVPVAHGEGNYYCDDETLLKLKENNQIVFTYDSVNPNGSRADIAGIVNERGNVLGMMPHPERAVEEIIGGTDGLRLFESVVKAWKEEQVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.973 kDa

MKFAVIQFPGSNCDLDMLHAIRDSLGEEAEYVWHAETSLEGFDAVLLPGGFSYGDYLRTGAIAKFSSIMPEVLRFAETGKPVLGVCNGFQILTEIGLLPGALIRNNNLHFICKTVPLRVVNGNTIFTGLYEDNEVIHVPVAHGEGNYYCDDETLLKLKENNQIVFTYDSVNPNGSRADIAGIVNERGNVLGMMPHPERAVEDIIGGTDGLRLFQSIVQAWKEEQVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.872 kDa

MKFAVLVFPGSNCDIDMYHAIKDELGEEVEYVWHTATDLSGFDGVLVPGGFSYGDYLRCGAMANQSNIMAEVKKVADAGKPVLGVCNGFQILTEAGLLPGALLRNTNLKFMCRTVQLKVENNNTLFTNQYEQGQIIHIPIAHGEGNYYCDEETLQSLKDNNQIVFTYSGDNPNGSLEDIAGIINERGNVLGMMPHPERAVDALVGGADGLAVFKSIVKQWRENHVNN

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.82 kDa

MKFAVCVFPGSNCDYDTYYVIRDILEKDVEFVYWEEKNLSKYDVVVLPGGFSFGDYLRPGALAARTPLAQAIYDFAQKGKYVIGICNGFQILTELGLLPGALLPNLNMRFVCKWVNLRVENERSAFTRKLEKGDVLRIPIAHHDGRYYVPEEELRKMEENGQILFRYCDEQGEVKEEVNPNGSVSNIAGVMNKEGNVFGMMPHPERASEDILGSHDGLMLWYSLLSD

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.411 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKQLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.411 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKQLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.425 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEIINIPIAHGEGNYYCDEETLKQLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.411 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKQLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.411 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKQLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.411 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKQLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.424 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKNEIINIPIAHGEGNYYCDEETLKQLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.107 kDa

MRWAIVRFPGANCDEDARFALEKAGIRAEFVWHTERDLRGFDGVFLPGGFSYGDYLRAGALAAKSPVMEAVRRFAEEGRYVVGVCNGFQILTEAGLLPGALLANLNLHFTCKEVGVRVERNDLPFTRLYPRGQVLRLPIAHGEGRYYADPETLARLEGEGLVVFRYAPLKDEADYNPNGSLHDIAGIVSEKGNVLGMMPHPERAVDEVLGNTDGLPFFLGLVREVAR

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.079 kDa

MRWAIVRFPGANCDEDARFALEKAGIRAEFVWHTERDLRGFDGVFLPGGFSYGDYLRAGALAAKSPVMEAVRRFAEEGRYVVGVCNGFQILTEAGLLPGALLANLNLHFTCKEVGVRVERNDLPFTRLYPRGQVLRLPIAHGEGRYYADPETLARLEGEGLVVFRYAPLKDEADYNPNGSLHDIAGIVSEKGNVLGMMPHPERAVDEVLGNTDGLPFFLGLVKEVAR

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.41 kDa

MHSSVITFPGSNCDRDMDVALKKFGFKNKMVWHDDVELPKSDLVVLPGGFSYGDYLRCGSMASKSKIMKSVLNFAQGGGKVMGVCNGFQILVESGLLPGVLLRNKYLEFICKNVFVKANNKDNSYFKDDKKNIYEFHIAHNEGNYFCSNDQIKEINDNNQIALFYSDENGNVNEQSNPNGSLQNIAGVFNKQKNVLGMMPHPERMIDPALSGEDGSIFFQNLINNLK

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.339 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDGYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKQLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.349 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALIRNENLKFMCRTVQLRVENNETMFTSQYEKDEIINIPIAHGEGNYYCDEATLKQLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.411 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKQLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.312 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEDVDYVWHDAENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGVLIRNQNLKFMCRTVPLRVENNETMFTSQYNKGEIIHIPIAHGEGNYYCDEATLKKLEQKNQIVFRYVDNPNGSVSDIAGIVNEKGNVLGMMPHPERAVNEILGGAEGLKVFQSILKYWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.411 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKKLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.349 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALIRNENLKFMCRTVQLRVENNETMFTSQYEKDEIINIPIAHGEGNYYCDEATLKQLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.411 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKKLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.161 kDa

MKFAVIVFPGSNCDADMYHAVKDALGEEVDYLWHTETSVEGYDAILLPGGFSYGDYLRSGSIARFSPIMEDVIRAANEGVPVLGVCNGFQVLLEAGLLPGAMLRNEKLTFICKPVELEVQNNDTFFTSEYEQGETITIPVAHGEGNYYCDDETLKQLEANNQVVFRYTDRVNGSRNHIAGIVNKAGNVLGMMPHPERAVEQLVGGEDGLRLFKSILRNWRESHVVTP

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.411 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKDEVINIPIAHGEGNYYCDEETLKQLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.704 kDa

MKFAVIVLPGSNCDIDMFHAIKDELGEEAEYVWHTETSLDEYDGVLIPGGFSYGDYLRCGAIARFANIMPAVKKAAEEGKPVLGVCNGFQILQELGLLPGAMRRNKDLKFICRPVELIVQNNETLFTSSYGKGESITIPVAHGEGNFYCDEETLAGLQENNQIAFTYGTDINGSVADIAGVVNEKGNVLGMMPHPERAVDSLLGSADGLKLFQSIVKNWRETHVATA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.819 kDa

MKFAVIVLPGSNCDIDMYHAIQDELGEQVEYVWHDETSLDGFDGVLVPGGFSYGDYLRCGAIARFSNIMPAVKKAAAEGKPVLGVCNGFQILQELGILPGAMRRNKDLKFICRPVELIVENNETQFTSGYQKGESISVPVAHGEGNFYCDEDTLAKLIENNQIAFTYGDDINGSVNRIAGITNEEGNVLGMMPHPERAVDSLLGSADGLKLFQSIVKNWRDTHVTTA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.776 kDa

MKFAVIVFPGSNCDADMYHAIKDGLGEEVEYVFHTETSLDGFDAVLLPGGFSHGDYLRSGAIARFAPIMPAVIQAAEAGKPVLGVCNGFQVLLEAGLLPGAMKRNIDLKFVCRTVELVVENNETMFSSGYEQGQTIRIPVAHGEGNYECDDETLAKLRENKQIVFRYNEHVNGSKGDIAGITNERGNVLGMMPHPERATETLLGNDQGLAVFTSILRNWRESHVTAS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.784 kDa

MKFAVIVLPGSNCDIDMYHAVKDELGHEVEYVWHEETSLDGFDGVLIPGGFSYGDYLRCGAIARFANIMPAVKQAAAEGKPVLGVCNGFQILQELGLLPGAMRRNKDLKFICRPVELIVQNDETLFTASYEKGESITIPVAHGEGNFYCDDETLATLKENNQIAFTYGSNINGSVSDIAGVVNEKGNVLGMMPHPERAVDELLGSADGLKLFQSIVKNWRETHVTTA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.642 kDa

MKFAVIVLPGSNCDIDMFHAVKDELGEEVEYVWHEETSLDGFDGVLIPGGFSYGDYLRCGAIARFANIMPAVKKAAAEGKPVLGVCNGFQILQELGLLPGAMRRNKDLKFICRPVELIVQNGGTLFTSSYEKGQSITIPVAHGEGNFYCDDETLERLKENNQIAFTYGGDINGSVSGIAGVVNEKGNVLGMMPHPERAVDELLGSADGLTLFRSIVKNWRETHVATA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

227 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.407 kDa

MKFAVIVFPGSNCDVDMFHAIKDELGEEVDYVWHDRENLDEYDAILLPGGFSYGDYLRCGAISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALMRNENLKFMCRTVQLRVENNETMFTSQYEKNEVINIPIAHGEGNYYCDEATLKQLEENNQIAFRYVENPNGSVSDIAGIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

226 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.702 kDa

MKFAVIVFPGSNCDLDMYHAVKDVLGEEAEYVFHTETSLEGFDGVLLPGGFSYGDYLRCGSIAQFSPIMAEVKRFAEEGRPVLGVCNGFQVLVEAGLLPGVLMRNRDLKFMCKTVDLVVENNETMFTSEYAAQETIRVPIAHGEGNYYCDDATLAALKANGQIAFTYKENPNGSVENIAGITNEAGNVLGMMPHPERAVEALLGGEDGKRLFTSIVKWGARHVTYN

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

226 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.5 kDa

MKIAVIVFPGSNCDIDLYEALKTVCGADVDYVDHQQTSLAGYDAVMLPGGFSYGDYLRAGAIARFAKIMPEVKRLADEGKPVFGTCNGFQILTEAGLLPGALKKNDSQNFVCKTTPLEVVNNQTIFTSQYQEHERINLPIAHADGSYFADQATLDELEANHQVVFRYAEENPNGSLNNIAGICNRAGNVLGMMPHPERAVEAILGNTDGLRVFKSLLENGTVIAEG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

226 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.737 kDa

MKFAVIQFPGSNCDFDLLWAIRDVMGAEAEFVWHDEKSLAGFDGVLIPGGFSYGDYLRCGAIASFANIMPEIKRLAKEGKPVFGTCNGFQILVESGLLPGVLIRNEGLKFVSKWQVLKVENNQSNFTTEYAKDALINLPIAHGEGQYVADEATLAELKENGQIVFTYADENPNGSVENIAGIINKEGNVLGMMPHPERAMEELLGGADGRKMFASLLKNFLVTVKN

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

226 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.894 kDa

MMKFAVPVFPGSNCDHDMVNALRDILHVTADLIPATATSLAGYDAVVLPGGFSYGDYLRSGAIARFAPIMPAVIAFANAGKPVIGICNGFQVLTEAGLLPGALQANRSAKFICQDSPLRIANHETIFTTAYGSTDQISLPIAHGEGNYYCDEATLAQLRANHQIIFEYVENPNGSTANIAGITNEAGNVLGMMPHPERAVEMILGSTDGLGIFQSVIASQEEVTHA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

226 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.732 kDa

MKIAVVVFPGSNCDVDLYEALHSVCHADVEYVSHRQKSLAGFDAVMLPGGFSYGDYLRAGAIARFTNIMPAIIKMANEGKPVFGTCNGFQILTEAGLLPGGLKRNDSQRFVCKTVPLEVVNSHTLFTSHYQDHERIALPIAHADGSYYADEKTLDELEANNQVVFRYATENPNGSLHNIAGITNKHGNVLGMMPHPERAVETILGSTDGLRLFESLLENGRIKVEA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

226 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.732 kDa

MKIAVVVFPGSNCDVDLYEALHSVCHADVEYVSHRQKSLAGFDAVMLPGGFSYGDYLRAGAIARFTNIMPAIIKMANEGKPVFGTCNGFQILTEAGLLPGGLKRNDSQRFVCKTVPLEVVNSHTLFTSHYQDHERIALPIAHADGSYYADEKTLDELEANNQVVFRYATENPNGSLHNIAGITNKHGNVLGMMPHPERAVETILGSTDGLRLFESLLENGRIKVEA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

226 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.729 kDa

MRFGIVVFPGSNCDIDCYYVLKDELQQEVEYIWHEEELKEGFDCIILPGGFSYGDYLRCGAVAQFSKVMEGVKVYAHAGGLVVGICNGFQILTEAGLLPGALVRNKGLKFICDTTPLKVTEANSPFTNQYQKGEVIQIPIAHGEGNYVVDEVTLAEMKTKGQILFTYGENPNGSTGDIAGICNEGKNVMGLMPHPERASEALLGNVDGKKFFQSIMHYLEGGKNND

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

226 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.528 kDa

MTARIGVVTFPGSLDDRDTQRAIRVAGAEPVALWHKDKDLKQVDAVVLCGGFSYGDYLRAGAIARFSPVMDTVIDQAKAGLPVLGICNGFQILTEAHLLPGGMLGNDHLHFICRDQKLRVENADTSWTSDYTAGQEIHIPLKNMDGRYVADRRTLDELEAEGRVAFRYLDMNPNGSLNDIAGITNAAGNVVGLMPHPEHAVESLIGTGRTDGLPFFTSILKKLVNA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

226 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

25.032 kDa

MVRVAVIRFPGTNCDLEMAWAVKLAGGDPEFVWHEDGGLDDFDAVIIPGGFTYGDYIRAGAIAALSPILEEIRECAEDGRPVLGVCNGMQILAEAELIPGTLTVNVGNRFICDWVYLRVERTDTPFTTKYQEDEVIRVPIAHAEGRYYYENPEEIEDNVVFRFCGPDGDVSEEYNLNGSVGGITGVVNDDGNVLGMMPHPERAAHRLLNSDDGLRLFESLVEWCRS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

225 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.803 kDa

MTAKIGVITFPGTLDDVDAQRAVRLAGAEAVSLWHADTDLKGVDAVVVPGGFSYGDYLRSGAISALAPVMQSVVDRARQGMPTLGICNGFQILTEAGLLEGALTRNKGLHFHCVDTHLEVVNNNTAWTTEFEAGDKIFVPAKHGEGRFQAAPETIDKLEGEGQVVFRYTDNFNGSLNDIAGITNETGRIVGLMPHPEHAIETLTGPSTDGLGLFVSAINAITATV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

225 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.108 kDa

MAKVRFGIVVFPGSNCDRDVAWVTRGLLGCPTRLIWHRETDLSGLDVVVLPGGFSYGDYLRAGALARFAPVMGSLAEHGARGGYVLGICNGFQILTEAGLLPGALVRNANLHFICDRVGIRVERQDLPWTSAYPCGATLTLPIAHGEGRYVCDADTLKQLQDRGQIVFRYAPVAPNGSVDNIAGICDPSGRILGLMPHPERAADPDLPGQDGIPFWQSIVQSLAG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

225 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.357 kDa

MAGVRFGVVVFPGSNCDRDVAWVTRGLLGCPTRLIWHRETDLSELDVVVLPGGFSYGDYLRCGAIARFAPVMGSLKEHAARGGYVLGICNGFQILTEAGLLPGALVRNANLHFICDRVGIRVERQDLPWTSAYPQGSTLTLPIAHGEGRYTCDPDTLKQLQDRGQIVFRYAPVAPNGSVDNIAGICDPSGRILGLMPHPERAADPDLPGQDGIPFWQSILRSFAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

225 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.658 kDa

MSARIGVITFPGTLDDVDAVRAVRLAGAEAVNLWHADADLKQVDAVIVPGGFSYGDYLRAGAIARFAPVMGEVVRAAEQGMPVLGICNGFQVLCEAGLLPGALTRNEGLHFICRDQWLTVESVSTAWTSRYEPGAQILIPLKSGEGRYQAAPAVLDELEGEGRVVFRYSGDNPNGSQRGIAGISSANGRVVGLMPHPEHATEALTGPSDDGLGLFLSVLDTLVTA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

225 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.927 kDa

MAFTSAVITFPGSNCDRDMAVAIEQVCGGTVHRVWHGDADLPEGLDFIALPGGFSYGDYLRSGAMAARSPVMQAVVRAAERGVTVLGVCNGFQVLTEAGLLPGALMRNAGIRFVCRDVKLTVENNQSLFTAGYDAGQQITIPVAHHDGNYFADDATLDRIEGEGRVAFRYAEEVNGSARNIAGVLNDRGNVLGMMPHPERMIEAAHGGSDGRALFESVVRGLVEA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

225 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.5 kDa

MSARVGVITFPGTLDDVDAARAVTLAGGEAVSLWHGDADLKGVDAVIVPGGFSYGDYLRCGAIARFAPVMGKVVQAAQGGMPVLGICNGFQVLCEAGLLPGALTRNEGLHFICRDEWLKVEATSTAWTSRYESGAEILVPLKSGEGRYQASENVLDELEGEGRVVFRYVGDNPNGSQRGIAGISSANGRVVGLMPHPEHATEALTGPSDDGLGMFYSVLDSVISA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.719 kDa

MKLAVIVFPGSNCDADLLWAVKEVMGIDAEFVRHDATSLAKFDGVLLPGGFSYGDYLRCGAIARFSPIINEVIRFATEGKMVFGTCNGFQILTEIGLLPGTLLRNDSLRFICKSVPLKVNTHTKFTSEYPENVSIHLPVAHGEGNYYCDEKTLKELKEKNQIVFTYQEKVNGSLANIAGICNEQGNVLGMMPHPERAMEELLGSTDGRSFFASIIKNFGKELSQ

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

22.98 kDa

MTVAVVRFGGSNCDRDAVRALAHLGVDAAVAWHDDGLPADTDGVVVPGGFSYGDYLRAGAMAAQSPVVAEVRALAADGVPVLGVCNGAQIGCEAGLAPGAFTTNASARFQCERVHLRVENATTPWTAAYSEGDVLEIPIAHGEGRFEIDDDAYADLVADDRVLFRYCNADGEVTEAANPNGSTGAVAGVTGDRDHVAVMMPHPERATLPALGATDGQGILGAFA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.239 kDa

MKFAVIQFPGSNCDIDLYEALHTVCGADVAYVPSKESSLDGFDAVMLPGGFSYGDYLRAGAIARFTNIMPAIVEMAKAGKPVFGTCNGFQILTEAGLLPGALKRNDSLKFVCKTVELEVANNDTIFTSEYQKGEKINLPIAHADGSFYADPETLQKIEDNGQVVFRYSKENPNGSLNNIAGITNERGNVLGMMPHPERAVEALLGNTDGLRLFKSILNHAEVKA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.497 kDa

MKIAVIVFPGSNCDIDLYEALHTVCDADVEYVSYKQDNLDGFDAVMLPGGFSYGDYLRCGAIARFSPIMPAVIEFAKNGKPVFGTCNGFQILTEVGLLPGALKQNNSLKFVCKTVELTVENTNTPFTSLYKKGEKINLPIAHADGSYYADEELLAELEENGQVVFRYSKENPNGSLNDIAGITNKQGNVLGMMPHPERAVEMLLGNEDGLRVFKSLLEEGKVKG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.723 kDa

MKFAVIVFPGSNCDVDCYYAVKDGLGEGVEYVWHQEKNLSKYDVIMLPGGFSYGDYLRAGAIARFSPVMEAVREEAEKGKFIIGICNGFQILTEAGLLPGALRKNEGLKFICKTVSIIVENDKTPFTTRLKKGQEILLPIAHGEGNYYVDDKTLKELKGNNQIVFRYKENINGSVERIAGVINKKGNVLGMMPHPERAYDSLLGNTDGLYILGSIVDNFVKGGV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.71 kDa

MVRIGVVTFPGTLDDQDAARAVRLAGAEPVSLWYASTDLAGVDAVILPGGFSYGDYLRAGALAAASPVMSSIRRAADGGLPVLGICNGFQVLCESHLLPGTLMRNEKRRFHCSVQQLQVASVDTVWTCDFRPSERIHIAAKHGEGNYVADAATVAALEANNRVVFRYTANPNGSVHDIAGITNEAGNVVGLMPHPEHSVEELTGAGTDGLGFFRSLMTFLSAQL

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.286 kDa

MKFGVVVFPGSNCDRDVAYVTRDLLGQPTRMVWHQDTDIADLDVVIIPGGFSYGDYLRCGAIARFSPVMQQVVEHAQKGKLVLGICNGFQVLTEAGLLPGALARNRDLHFICDRVPLTVESTNSLWTQAYNPGEVITLPIAHGEGRFYADEATLSEIEDNGQVLFRYAGENPNGSLNNIAGICDRQGNVLGMMPHPERASDPVLGGSDGLKLFQGLLEKVVALA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.65 kDa

MKVTILQFPGTNCEYDAQHAFKSLGAETEILWHKSDTIPSDTDLLIVAGGFSYGDYLRSGAIAKFSPVMKAVIKYADDGGKVLGICNGFQVLTESGLLPGALKRNESLHFLSKHHHLKVINNENIFLEKLDKGDIVNIPIAHHDGNYYIDDSGLKELYANNQVLLKYCDENGNDKNPNGSIDSIAGICNKERNVFGLMPHPERAMEAILGSDDGIKMLQGFLRA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.429 kDa

MTSFGIIVFPGSNCDRDIATVTAGLLDQPTRFIWHQETDLHGVDVVVLPGGFSYGDYLRCGAIARFSPIMTAIIDHANAGKRVLGICNGFQVLTEVGLLPGALIRNRDLHFICDRVTVRVESNQTVWTKGYQSQQVITLPIAHGEGRYFADGDTLKALEDNEQILFRYSNAQGELTTDSNPNGSLHNIAGITNVQGNVLGMMPHPERAADRLLKATDGLAMFIS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.633 kDa

MTARIGVVTFPGTLDDVDAARAARQVGAEVVSLWHADADLKGVDAVVVPGGFSYGDYLRAGAIARFAPVMDEVVAAADRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPLKSGEGRYVAPEKVLDELEGEGRVVFRYHDNVNGSLRDIAGICSANGRVVGLMPHPEHAIEALTGPSDDGLGLFYSALDAVLTG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.818 kDa

MNARIGVITFPGTLDDVDAARAARHVGAEAVSLWHADADLKGVDAVVVPGGFSYGDYLRAGAIARLSPIMTEVVDAVQRGMPVLGICNGFQVLCEAGLLPGALIRNVGLHFICRDVWLRVISTSTAWTSRFEPETDLLVSLKSGEGRYVASENVLDELDGEGRVVFRYHDNINGSLRDIAGISSANGRVVGMMPHPEHAIEVLTGPSDDGLGLFYSALDSVLAS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.684 kDa

MTARIGIITFPGTLDDVDAARAARRVGAQPVSLWHADADLKGVDAVVVPGGFSYGDYLRAGAIARFAPVMTEVVDAARRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPLKSGEGRYVAPADVLDELEGEGRVVFRYHENLNGSQRDIAGVSSADGRVVGLMPHPEHAIEALTGPSDDGLGLFYSVLDGVLAG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.633 kDa

MTARIGVVTFPGTLDDVDAARAARQVGAEVVSLWHADADLKGVDAVVVPGGFSYGDYLRAGAIARFAPVMDEVVAAADRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPLKSGEGRYVAPEKVLDELEGEGRVVFRYHDNVNGSLRDIAGICSANGRVVGLMPHPEHAIEALTGPSDDGLGLFYSALDAVLTG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.633 kDa

MTARIGVVTFPGTLDDVDAARAARQVGAEVVSLWHADADLKGVDAVVVPGGFSYGDYLRAGAIARFAPVMDEVVAAADRGMPVLGICNGFQVLCEAGLLPGALTRNVGLHFICRDVWLRVASTSTAWTSRFEPDADLLVPLKSGEGRYVAPEKVLDELEGEGRVVFRYHDNVNGSLRDIAGICSANGRVVGLMPHPEHAIEALTGPSDDGLGLFYSALDAVLTG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.031 kDa

MTVAIIRFGGSNCDRDAERALAHLDIDAEIVWHEDGLPEETTGVMIPGGFSYGDYLRAGAMAARAPIMDDVREQAEAGVPVLGVCNGAQIGSEGDLTPGAFTTNRSARFQCEPVYLRVENAETPWTEAYEDGEVIEVPIAHGEGRFEIADDELETLVDEDRVIFRYCDADGNVTDAANPNGSKDNVAGVLGEHESVAVLMPHPERASLPDIGPTDGQGVLEGFR

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.258 kDa

MKFGVVVFPGSNCDRDVAYVTRDLLGQPTRMVWHQDTDIADLDVVIIPGGFSYGDYLRCGAIARFSPVMQQVVEHAQKGKLVLGICNGFQVLTEAGLLPGALARNQDLHFICDRVPLTVESTNSLWTQAYNPGEVITLPIAHGEGRFYADEATLSEIEDNGQVLFRYAGENPNGSLNNIAGICDRQGNVLGMMPHPERASDPVLGGSDGLKLFQGLLEKVVALA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

224 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.686 kDa

MIAIIKFPGTTCETDVYKALIEAGVPTVIVKYKDFDPDRYNGVILPGGFSFGDYLRAGSIAASTETMKKVKQMAEDGKIVIGICNGFQILVESGLLKGALLPNLKLRFISKWVYLKVIRADTILTKGLDKKIIRMPIAHAEGRYYVDDIDYAKTHMVLQYCDENGNISEDVNPNGSLLNIASIANEEGNVIGMMPHPERASFKLTSIDGTVDGLILLRRLGEWA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.508 kDa

MKIAVVVFPGSNCDIDMYEAFHTVCKDDVEYVSYKEKSLDGFDVVVLPGGFSYGDYLRTGAIARFSNIIPAVENMAKEGKLVLGVCNGFQILTEMGLLPGALKKNDSLQFVCKTVTLEVENMHTPFTNEYADKEFIQIPIAHGDGSYYADENVLEELEDNHQVVFRYHGENPNGSLHDIAGICNKEGNVLGMMPHPERAVEEILGGIDGLPLFKSLLKAGVQA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.206 kDa

MKFAVIQFPGSNCDFDLLWAIRDVMGAEAEFVWHDEKSLAGFDGVLIPGGFSYGDYLRCGAIASFANIMPEIKRLAKEGKPVFGTCNGFQILVESGLLPGVLIRNEGLKFVSKWQALKVENNQSNFTTEYAKDALINLPIAHGEGQYVADEAQLAELKANGQIIFTYADENPNGSVENIAGIVNKEGNVLGMMPHPERAMEELLGGADGVDLFASVLKNFVGK

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.767 kDa

MKSAVILLPGLNRNRDMIAALTKITGQAPVTVWQTDTSIPDDVDLILIPGGFSYGDYLRCGAIAARMPVMQAVREKADKGVMVMGVCNGFQILLEAGLLPGALMRNASLKFVCREVKLEVTNANTSFTRGYKPGQIIRCPVAHHDGNYFADAETLKRLEGEGQVVFRYAEGTNPNGSVNDIAGIVNARGNVLGMMPHPENLIEAAHGGDDGRALFAGALGITA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.767 kDa

MKSAVILLPGLNRNRDMIAALTKITGQAPVTVWQTDTSIPDDVDLILIPGGFSYGDYLRCGAIAARMPVMQAVREKADKGVMVMGVCNGFQILLEAGLLPGALMRNASLKFVCREVKLEVTNANTSFTRGYKPGQIIRCPVAHHDGNYFADAETLKRLEGEGQVVFRYAEGTNPNGSVNDIAGIVNARGNVLGMMPHPENLIEAAHGGDDGRALFAGALGITA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.768 kDa

MKSAVILLPGLNRDRDMIAALTKITGQAPVTVWQTDTSIPDDVDLILIPGGFSYGDYLRCGAIAARMPVMQAVREKADKGVMVMGVCNGFQILLEAGLLPGALMRNASLKFVCREVKLEVTNANTSFTRGYKPGQIIRCPVAHHDGNYFADAETLKRLEGEGQVVFRYAEGTNPNGSVNDIAGIVNARGNVLGMMPHPENLIEAAHGGDDGRALFAGALGITA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.932 kDa

MKVAIIRFPGTNCEFDTTYAFEKLGVKTQIVWHEEKEFDADLVVLPGGFSYGDYLRCAAIAKLAPAMQGVFNHAKKGGYILGICNGFQILLESGLLKGAMKHNNNLSFISKNQSLRVVSNDNAFLKNFKKDEIINLPIAHGEGNYYADETTLKELQDKDLIILKYEPNPNGSVFDIAGICDENKKIFGLMPHPERACEKVLGNDVGLKMLKGFLLENFINFNF

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.681 kDa

MSAKIGVITFPGTLDDVDALRAVRIAGAEPVNLWHADEDLRGVDAVVVPGGFSYGDYLRTGAISALAPVMQSVIEAAGRGMPVLGICNGFQILTEARLLPGALTRNQGLHFHCVDTHLEVVNTDTAWTGTLEQGQKILVPAKHGEGRFQAEPDTIRMLEEEGRVVFRYTDNFNGSINGIAGITNETGRVVGLMPHPEHAVETLTGPSVDGLELFLSAIGTIAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.54 kDa

MSAKIGVITFPGTLDDVDAARAARIAGAEVISLWHADEDLKGVDAVVVPGGFSYGDYLRTGAISALAPVMQSVIEQAGKGMPVLGICNGFQILTEARLLPGALTRNKGLHFHCVDAHLVVENNTTAWTNTLEKGQQILIPAKHGEGRFQADAETIAQLEGEGRVVFRYTDNFNGSVNDIAGITNETGRIVGLMPHPEHAVEKLTGPSIDGLELFLSAVGTIAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.727 kDa

MTSRIGVITFPGTLDDVDAVRAVRLAGAEPVELWHADEDLKNVDAVVVPGGFSYGDYLRAGAIAAIAPAMKSVVAAAERGTPVLGICNGFQILQEAGLLPGALTRNEGLHFVCRDIYLDVENTSTAWTNQFAEGTKILVPSKHGEGRFQASEETLERLEGEGRVVFRYVENHNGSRNSIAGVCSENGRVVGLMPHPEHAVETLTGPSLDGLGLFQSVLSTLVS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.733 kDa

MKFAVLVFPGSNCDRDMYNAAIKSGVDAAYVDYRETTLDGFDGVLIPGGFSFGDYLRSGAMASVAPIIKEVKRFAKEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNETLKITNNQTPFTHLYVKNENVVYPVAHGEGHYYCTDEIYRELNDNNQIILKYTNNPNGSYEDIAGIVNKEGNVCGMMPHPERALETLLGTNSGVKLFESMVKSWREQNV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.464 kDa

MKFAVLVFPGSNCDRDMYNAAIKSGAQADYVDYRETSLDGYDGVLIPGGFSFGDYLRSGAMASVAPIINEVKRLANDGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNENLKIANNQTPFTNLYGENEIVVYPVAHGEGHYYCTDDIYNELVENNQIILTYEDNPNGSHENIAGIVNKAGNVCGMMPHPERALEKILGTDSGVKLFEAMVNSWREQNV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.635 kDa

MKFAVLKFPGSNCDRDMYNAALKSDVEAEYVDYRNTSLDGFDGVLIPGGFSFGDYLRSGAMASVAPITEAVKQFAKEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFVSRNESLRVVNHNTAFTNLYNEDETVVYPVAHGEGHYYCTQDMYDRLEANNQIILKYVNNPNGSFNDIAGIINEQGNVCGMMPHPERAIEPILGTDSGVKLFQAMVNSWREQNV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.803 kDa

MVKFAVVVFPGTNCDFETERAIRKAGAEAERVWYKTSLKDFDGVVLPGGFSYADYLRAGAIAARQEIIEEVKEFARDGKPVLGICNGFQVLTEAGLLPGALRPNKVPRFICRWVHLRVADTETPFTQFYEPGEVIRMPIAHAEGNYYADDPSKVRIAFQYSDEEGNITEEANPNGSLLNIAAIANENGNVLGTMPHPERASDRFLGSEDGLKLFRSMVEWARK

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.884 kDa

MPRFAVIVFPGTNCDFETVEAIRKAGGEAERVWYKESIREYDGVVLPGGFSYADYLRAGAIAARQRIMEEVREFAEEGRPVLGICNGFQVLTEAGLLPGALRPNKIPRFICKWIYLKVNDTNTAFTQLYEEGEIIRMPIAHAEGNYYVDDPSRIRIVFQYSDENGNLTEEANPNGSVMNIAGVSNEGGNVLGMMPHPERASDAFLGSEDGLKVFRSMVEYAKR

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.893 kDa

MVKFAVVVFPGTNCDFETVEAIKRAGGKAERVWYKDSIKDYDGVVIPGGFSYADYLRAGAIAARQRIMEEIRELAEEGRPILGICNGFQILTEAGLLPGALRPNKIPRFLCKWVHLKVVDVRTPFTYLYEEGEVVRMPIAHAEGNYYIDDPSKVRIVFQYSDEKGSITEEANPNGSVLNIAGVANMEGNILGMMPHPERASHYFLGSEDGLKVFKGMVEWVRS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.934 kDa

MVKFAVIVFPGTNCDFETVEAIKRAGGEAERVWYKQSVKDYDGVVIPGGFSYADYLRAGAIAARQKVMEEIRELAEEGRPILGICNGFQILTEANLLPGALRPNKIPRFLCKWVHLKVVDVETPFTYLYEEGEVVRMPIAHAEGNYYIDNPSKVRIVFQYSDEKGSITEEANPNGSVLNIAGVTNKQGNVLGMMPHPERASDRFLGSEDGLKVFKSIVEWMKK

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.745 kDa

MKSAVVQLPGLNRDRDMIAALTKISGHQPVTIWQTETEIPDVDLIVIPGGFSYGDYLRCGAIAARMPVMQAIIDKAAKGVKVLGVCNGFQILVEAGLLPGALMRNASLKFVCREIKLKVVNAETDFTRAYAQGQVIRCPVAHHDGNYFADEATLAKIEGNGQVLFRYAEGTNPNGSINDIAGVMNEKGNVLGMMPHPENLIEAAHGGSDGRGLFASALDVVAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.681 kDa

MKSAVVQLPGLNRDRDMIAALTKISGQPPVTIWQTETEIPDVDLIVIPGGFSYGDYLRCGAIAARMPVMQAIIDKASKGVKVLGVCNGFQILVEAGLLPGALMRNSSLKFVCREIKLEVVNAETDFTRAYAQGQVIRCPVAHHDGNYFADDATLAAIEGNGQVVFRYAEGTNPNGSINDIAAVMNEKGNVLGMMPHPENLIEAAHGGSDGRGLFASALDVIAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.492 kDa

MKSAVVQLPGLNRDCDMIAALTKISGKAPVTVWQTETEIPDVDLIVIPGGFSYGDYLRCGAIAARMPVMQAIKAKAEQGVRVLGVCNGFQILVEAGLLPGALMRNASLKFVCREVKLEVVNADTAFTRAYAKGQVIRSPVAHHDGNYFADAETLKAIEGNGQVVFRYAEGTNPNGSVNDIAGVLNAKGNVLGMMPHPENLIESAHGGADGRGLFASALDVIAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.498 kDa

MKTAIIQLPGLNRDRDMVAALHHITGVEPLKIWQTESTIPDVDVIVIPGGFSYGDYLRCGAIGARTPVLQAVREKAQKGVTVIGICNGFQILLEAGLLPGTLMRNTSLKFVCREIKLEVVNVNTKFSRYYSKGQIICCPVAHHDGNYFVDSETLKQMEENEQIIFRYAENTNPNGSVNDIAGIINKAGNILGMMPHPENFIEPAHGGTDGRLFFQSALELAKG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.701 kDa

MKTAIIQLPGLNRDQDMLVALHHITGVEPIKIWQTESTIPDVDVIVIPGGFSYGDYLRCGAIGARTPVLQAVREKAQKGVTVIGICNGFQILLEARLLPGALMRNTSLKFVCREIKLEVVNANTRFSRYYSKGQIIRCPVAHHDGNYFVDNETLKQMEDNEQIVFRYAENTNPNGSIRDIAGIINKAGNILGMMPHPENFIEPAHSGTDGRLLFQSALELTNG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.767 kDa

MKSAVILLPGLNRNRDMIAALTKITGQAPVTVWQTDTSIPDDVDLILIPGGFSYGDYLRCGAIAARMPVMQAVREKADKGVMVMGVCNGFQILLEAGLLPGALMRNASLKFVCREVKLEVTNANTSFTRGYKPGQIIRCPVAHHDGNYFADAETLKRLEGEGQVVFRYAEGTNPNGSVNDIAGIVNARGNVLGMMPHPENLIEAAHGGDDGRALFAGALGITA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.527 kDa

MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIISEVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGIVNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.527 kDa

MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIISEVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGIVNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.536 kDa

MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIISEVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNHTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGIVNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.527 kDa

MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIISEVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGIVNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.557 kDa

MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIISEVKRLATEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGIVNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.557 kDa

MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIISEVKRLATEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGIVNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.513 kDa

MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPVISEVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQKLKANNQIILKYVNNPNGSYDDIAGIVNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.526 kDa

MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIISEVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGIVNKKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.527 kDa

MKFAVLVFPGSNCDRDMFNAAIKSGVEAEYVDYRETSLSGFDGVLIPGGFSFGDYLRSGAMASVAPIISEVKRLAAEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNEELEIVNNQTAFTNLYEQGEKVIYPVAHGEGHYYCTDEIYQQLKANNQIILKYVNNPNGSYDDIAGIVNEKGNVCGMMPHPERALETLLGTDSGVKLFEAMVKSWREQHV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

223 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.733 kDa

MKFAVLVFPGSNCDRDMYNAAIKSGVDAAYVDYRETTLDGFDGVLIPGGFSFGDYLRSGAMASVAPIIKEVKRFAKEGKPVLGVCNGFQILTEIGLLPGALLHNDSHLFISRNETLKITNNQTPFTHLYVKNENVVYPVAHGEGHYYCTDEIYRELNDNNQIILKYTNNPNGSYEDIAGIVNKEGNVCGMMPHPERALETLLGTNSGVKLFESMVKSWREQNV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

222 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.706 kDa

MSVAIVRFPGTNCEFDTQYAFSLFGGVTYIVWHQDKSLPTDCHLVVIPGGFSYGDYLRCGAIAQFSPIMRVIKDFALQGGYVLGICNGFQILCEAGLLPGALKRNINLHFISQMQSLRIVSKNNAFLRSYAPNQEIRLPIAHADGNYFIDERELLELRANEQILLEYTDNPNGSVDSIAGICNEKKNVFGLMPHPERAIEDMLGSCDGKAMLDNLLHIAEMK

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

222 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.145 kDa

MKAAVLVFPGSNCDRDLAVGFRSAGFEVEMVWHKETALPAGIDVVGIPGGFSYGDYLRCGAIAAQSPIMRAVADFAGQGGHVLGVCNGFQVLCETRLLPGVLMRNGGIKFVCRAEPLVVASATSPFTDGYSIGDRIAVPVAHHDGNYQIDDEGLSALRSEDRIAFTYADNPNGSRADIAGVLSANRRVLGMMPHPERAVDVAHGGTDGSVLFASLAAALVAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

222 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.334 kDa

MKSAVIQLPGLNRDRDMIAALTKISGQAPVTVWQTETELPEVDLIVIPGGFSYGDYLRCGAIAARMPVMKAVAEKAAKGVLVIGVCNGFQILLEAGLLPGALMRNASLKFVCREVKLQVANANTAFTRAYAPGQIIRCPVAHHDGNFFAAPETLARIEGEGQVAFRYAEGTNPNGSINDIAGIVNGAGNVLGLMPHPENLVEAAHGGTDGRALFESVLGRAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

222 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.853 kDa

MRTAVIQFPGSNCDADALHAARLTLDPDAGFVWHTETALPRGTELVFLPGGFSYGDHLRSGAIAARSPIMAAVKAHAERGGFVLGVCNGFQVLTEAGLLPGALSRNRDLHFRCAPVHLRVENAQTVFTRAYQPGQILEIPIAHGEGNYYADPETIARLEAEGRVVFRYVDNPNGSLNDIAGIVNERGNVLGMMPHPERAVEALLGSEDGRGIFESLKGALVQ

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

222 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.625 kDa

MKSAVVLLPGLNRDRDMIAALTKISGKPPVTVWQTDTEIPDVDLIAIPGGFSFGDYLRCGAIAARMPVMRAVAEKAAKGVTVIGVCNGFQILVEAGLLPGALMRNTSLKFVCRQIKLEITNANTMFTRRYQPGQVIRSPVAHHDGNYFADAETLARLEGEGQVVFRYAEGTNPNGSINDIAGIINEQGNVLGLMPHPENLIEAAHGGSDGRALFEGALGIAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

222 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.432 kDa

MKAAVITFPGSNCDRDLATAFEKAGADVTRVWHKDTALPEGVDVVGVPGGFSFGDYLRCGAIAARSPIAAAMIRHAERGGYVLGICNGFQVLTETGLLPGALMRNAGLKFICRRVDLRVATADSAFTSGWAAGDAVRFPIAHHDGNYTADPETLARLRGEDRVAFTYLDNPNGSMEDIAGILSANRRVLGLMPHPERAVEEAQGGADGMGLFRALLGGMALV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

222 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.105 kDa

MHAAVVVFPGSNCDRDLAVAFEAAGAQVTKVWHKDTDLPEGVDIIGIPGGFSFGDYLRCGAIAANSPICRSVAAHAERGGYVIGICNGFQVLTETGLLPGALLRNAGLKYICKTVALKVETSASAFTEGYTAGDTISIPIAHHDGNYFADDETIARLQGEDRVAFTYEDTPNGAKADIAGILSSNRRVLGMMPHPERAADAGHGGTDGQALFRALTGALAAV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

222 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.153 kDa

MRAAVVVFPGSNCDRDLAVAFEQAGFDVSMVWHKDADLPQGIDIVGIPGGFSYGDYLRCGAIAAQSPICKAVVAHTARGGYALGVCNGFQVLTETGILPGALLRNAGLKYICKTVGLKVETSNSVFTEGYNAGDVIGIPIAHHDGNYYADDETLAALKAEDRIAFTYTDNPNGARDDIAGILSANRRVLGMMPHPERAADAGHGGTDGVALFRALAGALTPA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

222 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.254 kDa

MKAAVVVFPGSNCDRDLAVAFEQAGFDVSMVWHKDSELPEGVDIVGVPGGFSYGDYLRCGAIAAQSPICKAVVAHAERGGYALGVCNGFQILTETGVLPGALLRNAGLKYICKTVDLAVATSDSAFTQGYNAGDVIGVPIAHHDGNYYADDATVQMLKDQDRVAFTYVDNPNGSVADIAGILSENRRVLGMMPHPERAADEGHGGTDGVAMFRALSGLLTDA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

221 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.585 kDa

MKTAVIQFPGSNCDADALHAARLLLDDGAQFVWHTETALPEGTELVFLPGGFSYGDHLRSGAIAARSPIMNAVKAHAEAGGYVLGVCNGFQVLTEAGLLPGALSRNKELHFMCKPVHLRVENNATDFSRAYGPGQIIEIPIAHGEGNYYADAATIAELEEGGRVVFRYADNPNGSLNDIAGIVNERGNVLGMMPHPERAVELLLGSEDGKGVFESLKTVKK

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

221 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.601 kDa

MNVGVIVFPGSNCDRDVQWVTAGLLGQSTRMIWHEERDLSGLDLIVVPGGFSYGDYLRCGAIARFSPAMQATVAFAEAGGLVLGICNGFQILTEVGLLPGALVRNRDLHFRCETTPLRVERSDRPWSRTYQQGQILNLPIAHGEGRYHADPATLAALEANGQVLFRYLDNPNGSCNDIAGITNVAGNVLGMMPHPERAAEAIAGSVDGLGLFAGLLEPVAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

221 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.601 kDa

MNVGVIVFPGSNCDRDVQWVTAGLLGQSTRMIWHEERDLSGLDLIVVPGGFSYGDYLRCGAIARFSPAMQATVAFAEAGGLVLGICNGFQILTEVGLLPGALVRNRDLHFRCETTPLRVERSDRPWSRTYQQGQILNLPIAHGEGRYHADPATLAALEANGQVLFRYLDNPNGSCNDIAGITNVAGNVLGMMPHPERAAEAIAGSVDGLGLFAGLLEPVAA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

221 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.952 kDa

MKAAVLVFPGSNCDRDLAVAIEKICGTKPLMVWHQESELPDDLDLIAVPGGFSYGDYLRSGAMAARSAVMPAVIKQAERGVPVLGICNGFQILTEAGLLPGALMRNAGLSFICRNVGLEIQNTTSPFLRLYKKNQKIHLPVAHHDGNYTADEATLDQLEDEDRVALRYTESVNGSARNIAGVLNKKGNVLGLMPHPERMIEDAHGGKDGYNMFASLMQVMA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

221 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.512 kDa

MTDVADVNVGIIRFPGTNCDRDIEYAVNLVGANSHYIYWNETDLSQMDVVIIPGGFSYGDYLRAGSIAGITPIIDAIKDFAKKENPVLGICNGAQILGEIDLVPGVFIENENAKFICKSKKLKVNTTRTPFTKLYKKNEVIDLPIAHKEGRYYTDNLETLYDNNQIVLTFEDGNPNGSLDNITGVCNVDGNVVAVMPHPERAVEKLLRSEDGLKFFKSFLD

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

221 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.107 kDa

MDNFTVGVVVFPGSNCDRDVSWALEGCLDIRTKYLWHESSDLSDVDAIVLPGGFSYGDYLRCGAIARFSPLINALDEFVKSGKRVLGICNGFQILTESGFLPGALVANKNLNFICDDVELDIVSTKGGWFNNGDEKQTIKLPIAHGEGRYHCDSDTLKKLVDNELIALRYKNNPNGSSFDIAGITNEKGNVLGLMPHPERACDETIGGTDGLFTLKSLILK

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

221 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.127 kDa

MASFTVGIVVFPGSNCDRDVSWALEGCLDIKTKFLWHESSDLNDVDSIVLPGGFSYGDYLRCGAIARFSPLINSLHDFIKSGRRVLGICNGFQILTESGFLPGALVANKNLNFICDDVDLNVITSKGGWFQKLNENQNIKLPIAHGEGCYHCDQDTLKRLVDNDLIALKYKTNPNGSTSDIAGITNEKGNVLGLMPHPERACDESIGGIDGLYTLRSLITQ

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

221 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.097 kDa

MKTAVIVFPGSNCDRDMAVALETVTGKAPAMVWHRETGLPEGTDFIALPGGFSYGDYLRSGAMAARSPILRAVAEAAGRGVPVLGVCNGFQVLTEAGLLPGALMRNAGLNFVCRTVPLKVENSQSLFTAAYGAGEEIAIPVAHHDGNYFADADTLDRIEGEGRVAFRYLDGVNGSARDIAGVLNDAGNVLGMMPHPERAIDRAHGGTDGLRLFEAALGVLA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

220 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.388 kDa

MKAAVIVFPGSNCDRDCKVAIERSAGARVEMVWHQETALPDDLDLIVLPGGFSYGDYLRCGAMAAQSPVMKEVVSAAGKGVAVVGICNGFQVLTEVGLLPGALLRNAGLKYVCKPVELDIVNGQTRFTAGYGEQRQAVMTVGNGEGNYFADEETLDRLEGEGQVVFRYKENPNGSARDIAGIVNKGGNVLGLMPHPDRAFDADLGSEDGAVLFRSIFQSA

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

220 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.36 kDa

MRVGVVVFPGSNCDRDALHAVERAGAEPVELWHADADLKGSDAVILPGGFSYGDYLRPGAIARFARVMGPLEAFAREGGPVLGVCNGFQVLCEAHLLPGALLQNRGLRFVCRRVRVRVERADTPWTAACAPGEELTLPVAHNEGNYFADPATLARLEEEGRVVLRYLENPNGSANDIAGVCSEGRNVVGLMPHPERASDPLLGSGEGLGILRSVLAGAKV

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

219 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.117 kDa

MKIAVITFPGSNCDSDIYRVLKDQYNAEVDRIWHRDGLDKKYELVILPGGFSYGDYLRSGAMAGFSPVMKSVKEHVDKGGKLFGICNGFQILTEAEYLPGALIRNKTLKYICKTVILTKGSAGNPVTASMDVRKELKIPIAHADGCYYATSDVLKQLEDEDRILFRYSGENPNGSLDSIAGITSKNFKIVGMMPHPERAMNPITGEMDGKVVLDLILGS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

219 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.117 kDa

MKIAVITFPGSNCDSDIYRVLKDQYNAEVDRIWHRDGLDKKYELVILPGGFSYGDYLRSGAMAGFSPVMKSVKEHVDKGGKLFGICNGFQILTEAEYLPGALIRNKTLKYICKTVILTKGSAGNPVTASMDVRKELKIPIAHADGCYYATSDVLKQLEDEDRILFRYSGENPNGSLDSIAGITSKNFKIVGMMPHPERAMNPITGEMDGKVVLDLILGS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

218 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.299 kDa

MRVGILTFPGSNCDHDCYHVVKHVMGAEAQYVWHKDRLPEQLDAVVVPGGFSYGDYLRCGALARFSPVIADLVTFAEKGGPVLGICNGFQILCEAGLLPGVLMRNASLKYICKDVTIRVEGQETPVTRGLAGQSLTMPIAHAEGNYFADPETLDRLEGEGRVVFRYVGGAPNGSARDIAGISGGPARNVVGLMPHPDRASESILGLEEGKRMFAALLG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

218 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.985 kDa

MSIAVLRFPGTNCEFDMLHSFKLLGVESHLVWHQEKELPKGTHLVVIPGGFSYGDYLRSGAIARFSPIMQAVIRYAKEGGKVLGICNGFQILVESGLLPGALRRNENLHFVSKFQKLAVVSNNNPFLREYAVSETLNIPIAHADGNYFIDAKGLEELKENDQILLTYQGENPNGSIESIAGVCNKEKSVFGLMPHPERAMEPLLGSVDGARMLRGLAC

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

218 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

24.274 kDa

MRVGVIRFPGSNCDRDVHHVLELAGAEPEYVWWNQRNLDHLDAVVIPGGFSYGDYLRAGAIAAITPVMDAVRELVREEKPVLGICNGAQILAEVGLVPGVFTVNEHPKFNCQWTELRVKTTRTPFTGLFKKDEVIRMPVAHAEGRYYHDNISEVWENDQVVLQFHGENPNGSLDGITGVCDESGLVCAVMPHPERASEEILGSVDGFKFFRGILKFRG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

218 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.795 kDa

MTIGIVVFPGSNCDRDVHWATQGCLGMSTRFLWHESTDLNGLEAVVLPGGFSYGDYLRCGAIARFAPVLSSLLEFVNKGGKVLGICNGFQILTELGLLPGALTRNQELHFICDTVPLLISSQRTQWFKNYNQSKNIFLPIAHGEGRYQCSESILKKLQDEDSIALKYKNNPNGSINDIAAITNKSGNVLGMMPHPERAADKDIGGIDGIKILQALLSN

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

217 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.09 kDa

MSIGVLVFPGSNCDRDVQWATEGCLGMPTRRIWHEETDLSGLDAVVLPGGFSYGDYLRCGAIARFAPALQALLGFAAQGGRVLGICNGFQVLTELGLLPGALTRNRDLHFICEDAPLQVVSSRTPWLEHYGTDKALTLPIAHGEGRYQCSDDTLKQLQDADAIALRYQANPNGSVADIAGITNDSGNVLGLMPHPERACDPATGGTDGRVLLQGLLS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

217 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.23 kDa

MTIGVVVFPGSNCDRDVQWATEGCLNLPTRRLWHEETDLSGLDAVVLPGGFSYGDYLRCGAIARFAPVLQSLMDFASKGGRVLGICNGFQVLTELGLLPGALTRNQNLHFICEDAPLHVSSTRTDWLKAYGNAASLVLPIAHGEGRYQCSNDTLKQLQDQDCIALRYGSNPNGSVDDIAGITNPSGNVLGLMPHPERACDPATGGTDGRSMLKALLN

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

217 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.443 kDa

MSIGVVVFPGSNCDRDVRWAAQGCLNIPTRFLWHETRDLNGLDAVVLPGGFSYGDYLRCGAIARFAPVLESLVEFVARGGRVLGICNGFQVLTELGLLPGALTRNRSLHFICEDALLTVESNRTPWLMGHQRKDSLTLPIAHGEGRYQCSDETLCQLQDDDAIALRYVNNPNGSVADIAGITNKTGNVLGLMPHPERACDPVIGGVDGRGLLQSLLG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

217 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.562 kDa

MNIGIIVFPGSNCDRDVRWATEGCLGVPTSFLWHETTDLDGFDAIVIPGGFSYGDYLRCGAIARFAPVLNSLISFVDKGGKVLGICNGFQILTELGLLQGALTRNKNLHFICDRANLSIESTKSTWMKNYKKHDSISLPIAHGEGRYQCSSDVLKKLQDDDSVALRYADNPNGSIHDIAGITNKKGNVLGMMPHPERACDDALGDIDGKSILSTLLS

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

216 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.118 kDa

MSIGVIVFPGSNCDRDVQWATDGCLGMSTRRVWHEETDLSGFDAIILPGGFSYGDYLRCGAIARFAPALQSLIDFAAKGGRVLGICNGFQVLTELGLLPGALTRNQNLHFICEDAPLKVVSQRTAWMQGYNDRALTLPIAHGEGRYQCSDDTLKQLQDDDAIALSYGNNPNGSVFNIAGITNASGSVLGLMPHPERACDPAIGGTDGRRMLEALLG

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

213 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.588 kDa

MKPRACVVVYPGSNCDRDAYHALEINGFEPSYVGLDDKLDDYELIILPGGFSYGDYLRPGAVAAREKIAFEIAKAAERGKLIMGICNGFQILIEMGLLKGALLQNSSGKFICKWVDLIVENNDTPFTNAFEKGEKIRIPIAHGFGRYVKIDDVNVVLRYVKDVNGSDERIAGVLNESGNVFGLMPHPERAVEELIGGEDGKKVFQSILNYLKR

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

212 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL.

23.169 kDa

MRIAVLKFPGTNGDYDVLRALELAGARGELVWYRDYAAGKYDAVVLAGGFSYGDRLRAGAIAAATKAMDHVREDAERGVPVLGICNGFQILTEAGLLPGALIPNDPPGFISRWVAVRVVDTRTPFTYLYEEGEVVYMPIAHGEGRYVPAGEYKAAFKYVDNPNGSYDNVAGVYEKNVLGLMPHPERAVDPHVSRRGAGGLKLWLGLISWLRR

purQ

Phosphoribosylformylglycinamidine synthase subunit PurQ

54 amino acids

Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL (By similarity).

5.604 kDa

single

MHDIAGVTNETGNVLGMMPHPERAVEALLGGTDGLGVFQSLINQTEGADVRGAR