ptxA

Phosphite import ATP-binding protein PxtA

275 amino acids

Part of the ABC transporter complex PtxABC involved in phosphite import. Responsible for energy coupling to the transport system (Probable).

Belongs to the ABC transporter superfamily. Phosphonates importer (TC 3.A.1.9.1) family.

29.649 kDa

MTPHPIQDAVLRVDRLSVVYPGGVTALRDTSIAFRRGEFTVLLGLSGAGKSTLLRSLNRLVTPTGGSVTSELGELGSGSALRQHRRRTAMIFQHHQLIERQSALANVLTGRLAFHNTLRSLFPLPRADQEIALSCLARVGLADKALSRVDKLSGGQQQRVGIARALAQQPAIILADEPVASLDPATSVRVLGLLRDICKEDGITAIVSLHQLEYARRFADRVVGLADSQIVFDAAPSELTDAQLERIYAGRSTTQPANAPAEPPVMLEPSLEMSR

ptxA

Pertussis toxin subunit 1 homolog

269 amino acids

Belongs to the bacterial exotoxin subunit A family.

29.996 kDa

MRCTRAIRQTARTGWLTWLAILAVTAPVTSPAWADDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLEHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYPNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVTGACMARQAESPEAMAAWSERAGEAMVLVYYESIAYSF

ptxA

Pertussis toxin subunit 1 homolog

269 amino acids

Belongs to the bacterial exotoxin subunit A family.

30.065 kDa

MRCTRAIRQTARTGWLTWLAILAVTAPMTSPAWADDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLEHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEIRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRTVTRVYHNGITGETTTTEYPNLRYVSQQTRANTNPYTSRRSTASIVGTLVRMAPVTGACMARQAESPEAMAAWSERTGEAMVLVYYESIAYSF

ptxA

Pertussis toxin subunit 1

269 amino acids

S1 is an NAD-dependent ADP-ribosyltransferase, which plays a crucial role in the pathogenesis of B.pertussis causing disruption of normal host cellular regulation. It catalyzes the ADP-ribosylation of a cysteine in the alpha subunit of host heterotrimeric G proteins. In the absence of G proteins it also catalyzes the cleavage of NAD(+) into ADP-ribose and nicotinamide. It irreversibly uncouples the G-alpha GTP-binding proteins from their membrane receptors.

Belongs to the bacterial exotoxin subunit A family.

29.974 kDa

MRCTRAIRQTARTGWLTWLAILAVTAPVTSPAWADDPPATVYRYDSRPPEDVFQNGFTAWGNNDNVLDHLTGRSCQVGSSNSAFVSTSSSRRYTEVYLEHRMQEAVEAERAGRGTGHFIGYIYEVRADNNFYGAASSYFEYVDTYGDNAGRILAGALATYQSEYLAHRRIPPENIRRVTRVYHNGITGETTTTEYSNARYVSQQTRANPNPYTSRRSVASIVGTLVRMAPVIGACMARQAESSEAMAAWSERAGEAMVLVYYESIAYSF