PTF1A

Pancreas transcription factor 1 subunit alpha

328 amino acids

Transcription factor implicated in the cell fate determination in various organs. Binds to the E-box consensus sequence 5'-CANNTG-3'. Plays a role in early and late pancreas development and differentiation. Important for determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. May be involved in the maintenance of exocrine pancreas-specific gene expression including ELA1 and amylase. Required for the formation of pancreatic acinar and ductal cells. Plays an important role in cerebellar development. Directly regulated by FOXN4 and RORC during retinal development, FOXN4-PTF1A pathway plays a central role in directing the differentiation of retinal progenitors towards horizontal and amacrine fates.

34.97 kDa

MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEVEFLSHQLHEYCYRDGACLLLQPAPPAAPLALAPPSSGGLGEPDDGGGGGYCCETGAPPGGFPYSPGSPPSCLAYPCAGAAVLSPGARLRGLSGAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGGGAGGCGGPGGGGRLGGDSPGSQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS

Ptf1a

Pancreas transcription factor 1 subunit alpha

326 amino acids

Transcription factor implicated in the cell fate determination in various organs. Binds to the E-box consensus sequence 5'-CANNTG-3'. Plays a role in early and late pancreas development and differentiation. Important for determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. May be involved in the maintenance of exocrine pancreas-specific gene expression including ELA1 and amylase. Required for the formation of pancreatic acinar and ductal cells. Plays an important role in cerebellar development. Directly regulated by FOXN4 and RORC during retinal development, FOXN4-PTF1A pathway plays a central role in directing the differentiation of retinal progenitors towards horizontal and amacrine fates.

35.305 kDa

MDAVLLEHFPGALDTFPSSYFDEEDFFTDQSSRDPLEDGDELLGDEQAEVEFLSHQLHEYCYRDGACLLLQPAPSAAPHALAPPPLGDPGEPEDSGSYCCDAGAPLGAFPYSPGSPPSCLAYPCTAVLSPGTRLRGLNGAAAAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGTGGCGGPGGSRHLGGDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWADEKQLKEQNIIRTAKVWTPEDPRKLNSKSFDNIENEPPFEFVS

Ptf1a

Pancreas transcription factor 1 subunit alpha

324 amino acids

Transcription factor implicated in the cell fate determination in various organs. Binds to the E-box consensus sequence 5'-CANNTG-3'. Plays a role in early and late pancreas development and differentiation. Important for determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. May be involved in the maintenance of exocrine pancreas-specific gene expression including ELA1 and amylase. Required for the formation of pancreatic acinar and ductal cells. Plays an important role in cerebellar development. Directly regulated by FOXN4 and RORC during retinal development, FOXN4-PTF1A pathway plays a central role in directing the differentiation of retinal progenitors towards horizontal and amacrine fates.

35.185 kDa

MDAVLLEHFPGGLDTFPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDGACLLLQPAPSAAPHALAPPPLGDPGEPEDNVSYCCDAGAPLAAFPYSPGSPPSCLAYPCAAVLSPGARLGGLNGAAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGAGGCGGPGGSRHLGEDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSFDNIENEPPFEFVS

ptf1a

Pancreas transcription factor 1 subunit alpha

270 amino acids

Transcription factor implicated in the cell fate determination in various organs. Binds to the E-box consensus sequence 5'-CANNTG-3'. Acts together with pdx1 to induce the pancreatic lineage within the endoderm. Plays a central role in directing the differentiation of retinal progenitors towards horizontal and amacrine fates.

30.522 kDa

METVLEQLAGLESFPSPYFDEDDFFTDHSSRDALDADDFLEDDVDFLAGQIQDYYRDSRVLHTDDDYCDAGNFSFSSSSSGGFPYECGDGGCDLSPGMKGGSLVMKRRRRLRSDAEMQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSEMVQSDLPLRNPNSDSGNQPKKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLRDQNVVRTAKVWTPEDPRKLNKSPFSNIENEPPLTLCLDM

ptf1a

Pancreas transcription factor 1 subunit alpha

265 amino acids

Transcription factor implicated in the cell fate determination in various organs. Binds to the E-box consensus sequence 5'-CANNTG-3'. Required for exocrine pancreatic development. Plays a central role in directing the differentiation of retinal progenitors towards horizontal and amacrine fates.

30.447 kDa

MDTVLDPFTGLDSFSSSYFDDDDFFTDHSSRDHLDTDDFLDEDVDFLTNQIQEYYKDSRISQDGDYCDVGNFSFSSSSSTFSYGCADSTSELSPHRDGGLLKRRRRMRSEVEMQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLAELVQSDMPIRNPHSDALNQPKKVIICHRGTRSPSPNDPDYGLPPLAGHSLSWTDEKQLKDQNIIRTAKVWTPEDPRKLHLKSSINNIENEPPFNFIS