psmD10

26S proteasome non-ATPase regulatory subunit 10

232 amino acids

Acts as a chaperone during the assembly of the 26S proteasome, specifically of the 19S regulatory complex (RC).

25.307 kDa

MSGTKFRTGGTKEDDLLEFVKVGKLLEVKDLIENQGVKADCKDEDERTPLHWAAAKGQISVAQYLMDNCKCSPNTNDDGGWTPLTSATSAGHTHMVKLLLEFGADPNTVNDSKRTPLHYASSKGRSDIVDLLLTHGAKNRKDDTGSAPIHRASSNGSVATVERLLKGEANINSTNNEGDTPLHIAAEYNHEDVVECLLKHGADTTIENKDSKTPIDMSSSQTIKYLIKEFKK

Psmd10

26S proteasome non-ATPase regulatory subunit 10

231 amino acids

Acts as an oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4. Facilitates binding of MDM2 to p53/TP53 and the mono- and polyubiquitination of p53/TP53 by MDM2 suggesting a function in targeting the TP53:MDM2 complex to the 26S proteasome. Involved in p53-independent apoptosis. Involved in regulation of NF-kappa-B by retaining it in the cytoplasm. Binds to the NF-kappa-B component RELA and accelerates its XPO1/CRM1-mediated nuclear export (By similarity).

25.084 kDa

MEGCVSNIMICNLAYSGKLDELKERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLVKGAHVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYDATAMHRAAAKGNLKMVHILLFYKASTNIQDTEGNTPLHLACDEERVEEAKFLVTQGASIYIENKEEKTPLQVAKGGLGLILKRLAESEEASM

Psmd10

26S proteasome non-ATPase regulatory subunit 10

231 amino acids

Acts as an oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4. Facilitates binding of MDM2 to p53/TP53 and the mono- and polyubiquitination of p53/TP53 by MDM2 suggesting a function in targeting the TP53:MDM2 complex to the 26S proteasome. Involved in p53-independent apoptosis. Involved in regulation of NF-kappa-B by retaining it in the cytoplasm. Binds to the NF-kappa-B component RELA and accelerates its XPO1/CRM1-mediated nuclear export (By similarity).

24.985 kDa

MEGCVSNLMVCNLAYNGKLDELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNEKDDAGWSPLHIAASAGRDEIVKALLIKGAQVNAVNQNGCTALHYAASKNRHEIAVMLLEGGANPDAKNHYDATAMHRAAAKGNLKMVHILLFYKASTNIQDTEGNTPLHLACDEERVEEAKLLVTQGASIYIENKEEKTPLQVAKGGLGLILKRIAESEEASM

PSMD10

26S proteasome non-ATPase regulatory subunit 10

226 amino acids

Acts as an proto-oncoprotein by being involved in negative regulation of tumor suppressors RB1 and p53/TP53. Overexpression is leading to phosphorylation of RB1 and proteasomal degradation of RB1. Regulates CDK4-mediated phosphorylation of RB1 by competing with CDKN2A for binding with CDK4. Facilitates binding of MDM2 to p53/TP53 and the mono- and polyubiquitination of p53/TP53 by MDM2 suggesting a function in targeting the TP53:MDM2 complex to the 26S proteasome. Involved in p53-independent apoptosis. Involved in regulation of NF-kappa-B by retaining it in the cytoplasm. Binds to the NF-kappa-B component RELA and accelerates its XPO1/CRM1-mediated nuclear export.

24.428 kDa

MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG