psbJ-A

Photosystem II reaction center protein J

40 amino acids

One of the components of the core complex of photosystem II (PSII). PSII is a light-driven water:plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation.

Belongs to the PsbJ family.

4.115 kDa

MADTTGRIPLWIIGTVAGIPVIGLIGIFFYGSYSGLGSSL