About Services Plasmids Contact

ppaX

Gene
ppaX
Protein
Putative pyrophosphatase PpaX
Organism
Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Length
220 amino acids
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
25.682 kDa
Sequence
MKITAVLFDLDGTIIDTNQLIIKSFVYTVEKHLGYKIGAEEVIPYFGEPLPLTLQRFSKDKWEIMLKTYRDYNEKYHDRYTKIREDVKEVLARLKEEGIKTAVVTSKRRELAKRGLKLFELDKYFDVLVGLEDTEKHKPEPDPVLKALELLKSPREEALMVGDSPYDILSARSAGVRSVAVKWSVLPFELLKKEKPDYFIEDMWQLLKIIKGCDEDEHEQ

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Length
217 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.712 kDa
Sequence
MTGKITTLLFDLDGTLINTNELIIKTFQVTLQEFLPDRVFTREDILPFIGPSLMETFREINPAHADEMRAFYREYNLKHHDDLILEYDGVYEAIRALYEEDYKLGIVSTKMYDTIMRGLKVTGLDKFFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDIEAGKNAETLTAGVAWAIKGPEHLAQFQPDFMLEKMSDLLAIVRDEE

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334)
Length
217 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.768 kDa
Sequence
MTGKITTLLFDLDGTLINTNELIIKTFQATLQEFLPDRVFTREDILPFIGPSLMETFREINPAHAEEMRVFYREYNLKHHDDLILEYEGVYEAIRVLYEEDYKLGIVSTKMYDTIMRGLKVTGLDKFFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDIEAGKNAETLTAGVAWAIKGPEHLAQFQPDFMLEKMSDLLAIVRDEE

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Length
217 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.726 kDa
Sequence
MTGKITTLLFDLDGTLINTNELIIKTFQATLQEFLPDRVFTREDILPFIGPSLMETFREINPAHAEEMRVFYREYNLKHHDDLILEYDGVYEAIRALYEEDYKLGIVSTKMYDTIMRGLKVTGLDKFFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDIEAGKNAETLTAGVAWAIKGPEHLAQFQPDFMLEKMSDLLAIVRDEE

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Listeria monocytogenes serotype 4b (strain CLIP80459)
Length
217 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.764 kDa
Sequence
MTGKITTLLFDLDGTLINTNELIIKTFQVTFQEFMPDRVFTREDILPFIGPSLMETFREINPAHADEMRAFYREYNLKHHDDLILEYDGVYEAIRALYEEDYKLGIVSTKMYDTIMRGLKVTGLDKFFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDIEAGKNAETLTAGVAWAIKGPEHLAQFQPDFMLEKMSDLLAIVRDEE

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Listeria monocytogenes serotype 4b (strain F2365)
Length
217 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.764 kDa
Sequence
MTGKITTLLFDLDGTLINTNELIIKTFQVTFQEFMPDRVFTREDILPFIGPSLMETFREINPAHADEMRAFYREYNLKHHDDLILEYDGVYEAIRALYEEDYKLGIVSTKMYDTIMRGLKVTGLDKFFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDIEAGKNAETLTAGVAWAIKGPEHLAQFQPDFMLEKMSDLLAIVRDEE

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Listeria monocytogenes serotype 4a (strain HCC23)
Length
217 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.712 kDa
Sequence
MTGKITTLLFDLDGTLINTNELIIKTFQVTLQEFLPDRVFTREDILPFIGPSLMETFREINPAHADEMRAFYREYNLKHHDDLILEYDGVYEAIRALYEEDYKLGIVSTKMYDTIMRGLKVTGLDKFFQVVIGLDQVSNAKPDPEGIEMALSLLNATKEEAIMIGDNYHDIEAGKNAETLTAGVAWAIKGPEHLAQFQPDFMLEKMSDLLAIVRDEE

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus anthracis (strain A0248)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.767 kDa
Sequence
MKINTVLFDLDGTLINTNELIISSFLHTLHTYYPNQYKREDVLPFIGPSLHDTFSKIDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGLKLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLETYKPDFMLDKMSDLLLILSDMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus anthracis (strain CDC 684 / NRRL 3495)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.751 kDa
Sequence
MKINTVLFDLDGTLINTNELIISSFLHTLHTYYPNQYKREDVLPFIGPSLHDTFSKIDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGLKLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLETYKPDFMLDKMSDLLPILSDMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus thuringiensis (strain Al Hakam)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.721 kDa
Sequence
MKINTVLFDLDGTLINTNELIISSFLHTLHTYYPNQYKREDVLPFIGPSLHDTFSKIDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGLKLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSDMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus anthracis
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.767 kDa
Sequence
MKINTVLFDLDGTLINTNELIISSFLHTLHTYYPNQYKREDVLPFIGPSLHDTFSKIDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGLKLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLETYKPDFMLDKMSDLLLILSDMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus cereus (strain AH820)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.663 kDa
Sequence
MKINTVLFDLDGTLINTNELIISSFLHTLHTYYPNQYKREDVLPFIGPSLHDTFSKIDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGLKLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLGAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSDMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus cereus (strain ATCC 10987 / NRS 248)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.755 kDa
Sequence
MKINTVLFDLDGTLINTNELIISSFLHTLHTYYPNQYKREDVLPFIGPSLHDTFSKIDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGLKFSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSDMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus cereus (strain G9842)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.773 kDa
Sequence
MRINTVLFDLDGTLINTNELIISSFLHTLNTYYPNQYKREDVLPFIGPSLHDTFSKIDESKVEEMITSYREFNHDHHDELVEEYETVYETVRELKKQGYKVGIVTTKARQTVEMGLQLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALELLDAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSNMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus cereus (strain 03BB102)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.721 kDa
Sequence
MKINTVLFDLDGTLINTNELIISSFLHTLHTYYPNQYKREDVLPFIGPSLHDTFSKIDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGLKLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSDMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus cereus (strain B4264)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.804 kDa
Sequence
MRINTVLFDLDGTLINTNELIISSFLHTLNTYYPNQYKREDVLPFIGPSLHDTFSKIDENKVEEMITSYRKFNHDHHDELVEEYETVYETVRELKRQGYKVGIVTTKARQTVEMGLQLSKLDEFFDVVVTIDDVENVKPHPEPLQKALELLDAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSNMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus cereus (strain AH187)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.699 kDa
Sequence
MKINTVLFDLDGTLINTNELIISSFLHTLNTYYPDQYKREDVLPFIGPSLHDTFSKIDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGLKLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSDMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus cereus (strain Q1)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.699 kDa
Sequence
MKINTVLFDLDGTLINTNELIISSFLHTLNTYYPDQYKREDVLPFIGPSLHDTFSKIDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGLKLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSDMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.773 kDa
Sequence
MRINTVLFDLDGTLINTNELIISSFLHTLNTYYPNQYKREDVLPFIGPSLHDTFSKIDESKVEEMITSYREFNHDHHDELVEEYETVYETVRELKKQGYKVGIVTTKARQTVEMGLQLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALELLDAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSNMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus cereus (strain ZK / E33L)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.721 kDa
Sequence
MKINTVLFDLDGTLINTNELIISSFLHTLHTYYPNQYKREDVLPFIGPSLHDTFSKIDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGLKLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSDMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.721 kDa
Sequence
MKINTVLFDLDGTLINTNELIISSFLHTLHTYYPNQYKREDVLPFIGPSLHDTFSKIDESKVEELITSYRQFNHDHHDELVEEYETVYETVQELKKQGYKVGIVTTKARQTVEMGLKLSKLDEFFDVVVTIDDVEHVKPHPEPLQKALQLLDAKPEEALMVGDNHHDIVGGQNAGTKTAAVSWTLKGRAYLEAYKPDFMLDKMSDLLPILSDMNRS

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus pumilus (strain SAFR-032)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.27 kDa
Sequence
MNESTINTVLFDLDGTLINTNELIIASFQHTLDHYYPGQYSREEILHFIGPSLFDTFSAMDPDLTDDMIQMYRTFNHEQHDLLVTEYETVLDTLKVLQDRGFKLGIVTTKIRDTVLMGLKLTGLEPFFEVIVTLDDVQNEKPHPEPVQLALSKLGSDPHEAVMVGDNYHDILSGQAAGTKTAGVAWSIKGEEALFKHRPDFMLKKMSDLLAIVGAD

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus subtilis (strain 168)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.004 kDa
Sequence
MSDKQVTTILFDLDGTLINTNELIIASFLHTLEHYYPSKYKREDVLAFIGPSLFDTFSSMDPDKCEDMIAMYRAYNHDMHDSLVTEYETVYETLDALKKAGFTLGIVTTKLRDTVNMGLKLTGIGEFFETVVTLDDVTNAKPDPEPVLLALKQLGSEPAEAIMVGDNYHDVLAGKNAGTKTAGVAWTIKGPEMLAKHEPDFMLEKMSDLLQIVGVK

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)
Length
216 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.097 kDa
Sequence
MTDKRVTAILFDLDGTLIDTNELIIASYLHTLDHYCPGQFKREDVLPFIGPPLYETFSGINAEKCDEMISMYRAFNHEKHDELVTEYETVYETLDELKKAGYQLGIVTTKLRDTVNMGLKLTGIGAFFDTVVTLDDVKHPKPDPEPVRLALSRLGCDPSEAIMVGDNYHDVMAGKNAGTKTAGVAWTIKGAQTLSAYEPDYMLEKMSDLLHITGVK

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Length
215 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.441 kDa
Sequence
MNINTILFDLDGTLINTNDLIIESFLHTLNHYYPNQYTREDVLAFIGPPLRDTFEAIDPERVDEMIETYRAFNHAHHDALVKEYETVYDTVQTLHEKGFKLGIVTTKIRHTVNMGLKLTKLDSFFKCVITLDDVEHAKPHPEPIEKALACLQAKPEETLMVGDNHHDILAGKHAGTKTAGVAWTIKGREHLATYEPDFMLEKMSDLLSILGVTSR

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Length
215 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.216 kDa
Sequence
MEINTVLFDLDGTLINTNELIISSFLHTFETYYPGKYGRKDAIECIGPPLTDSFKRLDPERVEEMVATYRKHNHAHHDKLVEPYEGVYETVKTLHEQGFKLAIVTTKIRETAMKGLKLFGLDEFFDVIVALDDVENVKPNPEPLEKAMNALGAKKEETIMVGDNSHDILGGKNAGVKTAVVGYAIRGEDYVRQFDPDYVLRSMPDLLDIVGVKAR

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Bacillus weihenstephanensis (strain KBAB4)
Length
215 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.607 kDa
Sequence
MKINTVLFDLDGTLINTNELIISSFLHTLNHYYSNQYKREDVLPFIGPSLHDTFSKIDASKVEEMITCYRQFNHEHHDELVEEYETVYETVQELKKQGYKIGIVTTKARQTVEMGLKLSKLDQFFDVVVTIDDVEHVKPHPEPLQKALELLDAKPEETLMVGDNHHDIVGGQNAGTKTVAVSWTLKGRAYLEAYKPDYVLDKMSDLLPILSRING

Gene
ppaX
Protein
Pyrophosphatase PpaX
Organism
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Length
214 amino acids
Function
Hydrolyzes pyrophosphate formed during P-Ser-HPr dephosphorylation by HPrK/P. Might play a role in controlling the intracellular pyrophosphate pool.
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.442 kDa
Sequence
MSIRTILFDLDGTLIDTNTLIKASFEHTFKEYNLNFSNEEILKFNGPPLVDTFNKIDETKADRMITTFREHNIREHDNFVTAFPHVYDTLEELQNRNISLGIVSTKMRHTVHMGLELTGISKFFSTIITYDDVTHAKPHPEPVQMAMQKLGAHPEHTLMVGDNHHDIVSGQRANVQTAAVAWSLKDTNYLKSFHPDYIIEDIKDIITIVGDSFA

Gene
ppaX
Protein
Putative pyrophosphatase PpaX
Organism
Clostridium perfringens (strain 13 / Type A)
Length
214 amino acids
Similarity
Belongs to the HAD-like hydrolase superfamily. PpaX family.
Mass
24.081 kDa
Sequence
MIKAVLFDLDGTLINTNDLILKSFKHTFKTMLDLEPSEEEITMNYGRPLQEIFKSYDENRIEEMINCYRKINLELHDDECKEFADVDLMLKTLKSKGIKIGVVTSKKSDMAERGAKLMGIFKYFDTFITPEITTKHKPDGEPVLKACENLGVSPSEALMVGDSPYDILAGKNAGAKTCGVKYTALPLEKLGESNPDFYVDKPLEILDLVEKLNS