About Services Plasmids Contact

ppaC

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Length
548 amino acids
Similarity
Belongs to the PPase class C family.
Mass
61.364 kDa
Sequence
MKALERVYVIGHKNPDTDSVCSAIGYAHFKNNVEKGKTFIPARSGDLTNESLFVLKYFGMNPPLHIETLEPTVEDLELKNPIFVTPDTSAYDVAMLMESRGIKNVPVVSKEKMIGVVTESNIARVYVRRLKIEPLVIHPVPFDQLVRILKAEVVCDYMKEKTVSGKVHIAVDALHVLLGKIEIGDVVIVGDNEPAQIALLEKGAKLMIVVNNAPVSNRVLEIAKEKNAAVLRVKFDAFSAAKLINLSLPVTLVMSKKFPTVTKKDTLEEVKEIVFTSKIRAAFVEDEKGRLCGVITRTDLLKDVRKKVILVDHNEITQAPEGVEKAEILEIIDHHRLGGLSTLNPVFFYNEPVGSTSTIVAEFFLKNGVKMEREIAGILLSGIVSDTLFFKLSTTTEKDRKMANFLADVAKLDLEKFAKKLLKEGMKIPEDVDPAELLKRDVKVYEMGEESFAVSQIMTSDFSTLLKEKERFMNTLKTLKGEFGVKHFFVLFTNPVEEASLLMMDGDQKLVEKAFNAEKKDGLFLLKGVMSRKKDFVPKIGEVLRRER

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Length
322 amino acids
Similarity
Belongs to the PPase class C family.
Mass
35.395 kDa
Sequence
MEHVVYVVGHKNPDTDSVCSAIAFAYLWNKWKEGGNVAKMMKIEAEAKPVIQGDVNPETKYVLEKFGFEVPEIMTNGEGKKVALVDHSEKAQTVDGIDKAEVVAIVDHHKIGDVTTPQPILFVNLPVGCTATVIKLLFDKTGVEIPKDIAGILLSSILSDTVIFKSATTTELDKEVAEELAKIAGIDDLTKFGVEIKAKLSAVDDLTAMDIIKRDYKDFDMSGKKVGVGQIELVDLSLIESRIDEIYEAMKKMKEEGGYAGIFLMLTDIMKEGTELLVVTDYPEVVEKAFGKKLEGKSVWLDGVMSRKKQVVPPLEKAFAEL

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Length
314 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.039 kDa
Sequence
MLAVFGHLNPDTDAISAAMVYARLLTRQGTEAQAYRLGEPNFETAYVLRELGLEAPPLLTELPAGSKVALVDHNESAQSLPALGELDVTRVVDHHKLGDLTTINPPYLRFEPVGCTGTILLKLHREAGLSVEPQDAKLMLSAILSDTLHFRSPTTTQDDRDAVAFLAPVAGVNDVEAYALAMFAAKSDLGNTPAETLLRMDYKVFPFGDPVQPQNWGIGVIETTNPAYVFGRQQELLAAMDQVKAEDTLSGMLLSVVDILNETNRTLVLGATEAKVLREAFGAEAEGQVADLGNRISRKKQIVPTLEKYFAPEA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Lactococcus lactis subsp. lactis (strain IL1403)
Length
314 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MSDKILVFGHQKPDTDAIGSSYGFSYLSNHRPNGALNTEVVALGTPNEETQFVLDYFGVKAPRVVKSAKEEGVDTVILTDHNEFQQSISDIEDLTIYGVVDHHRVANFNTAAPLFMTVEPVGSASSIVYRKFLEANVEIPKEVAGLLLSGLISDTLLLKSPTTHVTDHKVAKELAEIAGVNLEEYGLAMLKAGTNLSTKTAEELIDIDAKTFELNGSNVRIAQVNTVDIPEVLERLSDIKAAINASMTANGYDDFVFMITDIVNSNSEIIALGAHPEKSEAAFNFTLADDHAFLAGAVSRKKQVVPQLTESFNK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.597 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAWGLDTEAVALGTPNEETAYVLDYFGVQAPRVVESAKAEGVETVILTDHNEFQQSISDIKDVTVYGVVDHHRVANFETANPLYMRLEPVGSASSIVYRMFKENGVSVPKELAGLLLSGLISDTLLLKSPTTHASDIPVAKELAELAGVNLEEYGLEMLKAGTNLSSKTAAELIDIDAKTFELNGEAVRVAQVNTVDINDILARQEEIEVAIQEAIVTEGYSDFVLMITDIVNSNSEILALGSNMAKVEAAFEFTLENNHAFLAGAVSRKKQVVPQLTESYNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus agalactiae serotype III (strain NEM316)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.597 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAWGLDTEAVALGTPNEETAYVLDYFGVQAPRVVESAKAEGVETVILTDHNEFQQSISDIKDVTVYGVVDHHRVANFETANPLYMRLEPVGSASSIVYRMFKENGVSVPKELAGLLLSGLISDTLLLKSPTTHASDIPVAKELAEIAGVNLEEYGLEMLKAGTNLSSKTAAELIDIDAKTFELNGEAVRVAQVNTVDINDILARQEEIEVAIQEAIVTEGYSDFVLMITDIVNSNSEILALGSNMAKVEAAFEFTLENNHAFLAGAVSRKKQVVPQLTESYNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.597 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAWGLDTEAVALGTPNEETAYVLDYFGVQAPRVVESAKAEGVETVILTDHNEFQQSISDIKDVTVYGVVDHHRVANFETANPLYMRLEPVGSASSIVYRMFKENGVSVPKELAGLLLSGLISDTLLLKSPTTHASDIPVAKELAELAGVNLEEYGLEMLKAGTNLSSKTAAELIDIDAKTFELNGEAVRVAQVNTVDINDILARQEEIEVAIQEAIVTEGYSDFVLMITDIVNSNSEILALGSNMAKVEAAFEFTLENNHAFLAGAVSRKKQVVPQLTESYNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus equi subsp. equi (strain 4047)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.713 kDa
Sequence
MSKLLVFGHQNPDTDAIASSYAFDYLAKKAFDLDTEVVALGDPNEETAFALDYFGVSAPRVVTSAKAEGASHVILTDHNEFPQSISDIREVEVYGIVDHHRVANFETANPLYMRVEPVGSASSIVYRLFKENRVDVPKDIAGMLLSGLISDTLLLKSPTTHASDHRVAAELAELAGVKLEEYGMAMLKAGTNLASKSEAELIDIDAKTFELNGNAVRVAQVNTVDIAEVLERKEAIEAAIREVMASEGYSDFVLMITDIVNSNSEILALGANMDKVEAAFSFKLEDNHAFLAGAVSRKKQVVPQLTESFGA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.753 kDa
Sequence
MSKLLVFGHQNPDTDAIASSYAFDYLAKKAFDLDTEVVALGDPNEETAFALDYFGVSAPRVVTSAKAEGASHVILTDHNEFPQSISDIREVEVYGIVDHHRVANFETANPLYMRVEPVGSASSIVYRLFKENRVDVPKDIAGLLLSGLISDTLLLKSPTTHASDHRVAVELAELAGVKLEEYGMAMLKAGTNLASKSEAELIDIDAKTFELNGNAVRVAQVNTVDIAEVLERKEAIEAAIKEVMASEGYSDFVLMITDIVNSNSEILALGANMDKVETAFDFKLEDNHAFLAGAVSRKKQVVPQLTESFGA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.541 kDa
Sequence
MSKILVFGHQNPDSDAIGSSYAFAYLAREAYGLDTEAVALGEPNEETAFVLDYFGVAAPRVITSAKAEGAEQVILTDHNEFQQSVADIAEVEVYGVVDHHRVANFETANPLYMRLEPVGSASSIVYRMFKEHSVAVSKEIAGLMLSGLISDTLLLKSPTTHPTDKAIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAIEKAIADNGYSDFVLMITDIINSNSEILAIGSNMDKVEAAFNFVLENNHAFLAGAVSRKKQVVPQLTESFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pyogenes serotype M1
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.617 kDa
Sequence
MSKILVFGHQNPDTDAIASSYAFDYLSQKAFGLDTEVVALGTPNEETAFALDYFGVEAPRVVESAKAQGSEQVILTDHNEFQQSIADIREVEVYGVVDHHRVANFETANPLYMRVEPVGSASSIVYRMFKENGIEVPKAIAGMLLSGLISDTLLLKSPTTHVSDHLVAEELAELAEVNLEDYGMALLKAGTNLASKSEVELIGIDAKTFELNGNAVRVAQVNTVDIAEVLERQEAIEAAIKDAMAAEGYSDFVLMITDIVNSNSEILAIGANMDKVEAAFNFTLDNNHAFLAGAVSRKKQVVPQLTESFGA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.479 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAYGLDTEAVALGTPNEETAFVLNYFGVEAPRVITSAKAEGAEQVILTDHNEFQQSVSDIAEVEVYGVVDHHRVANFETASPLYMRLEPVGSASSIVYRMFKEHGVAVPKEIAGLMLSGLISDTLLLKSPTTHPTDKIIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAMQAANESNGYSDFVLMITDIVNSNSEILALGANMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTESFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.617 kDa
Sequence
MSKILVFGHQNPDTDAIASSYAFDYLSQKAFGLDTEVVALGTPNEETAFALDYFGVEAPRVVESAKAQGSEQVILTDHNEFQQSIADIREVEVYGVVDHHRVANFETANPLYMRVEPVGSASSIVYRMFKENGIEVPKAIAGMLLSGLISDTLLLKSPTTHVSDHLVAEELAELAEVNLEDYGMALLKAGTNLASKSEVELIGIDAKTFELNGNAVRVAQVNTVDIAEVLERQEAIEAAIKDAMAAEGYSDFVLMITDIVNSNSEILAIGANMDKVEAAFNFTLDNNHAFLAGAVSRKKQVVPQLTESFGA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pneumoniae serotype 19F (strain G54)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.479 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAYGLDTEAVALGTPNEETAFVLNYFGVEAPRVITSAKAEGAEQVILTDHNEFQQSVSDIAEVEVYGVVDHHRVANFETASPLYMRLEPVGSASSIVYRMFKEHGVAVPKEIAGLMLSGLISDTLLLKSPTTHPTDKIIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAMQAANESNGYSDFVLMITDIVNSNSEILALGANMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTESFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.617 kDa
Sequence
MSKILVFGHQNPDTDAIASSYAFDYLSQKAFGLDTEVVALGTPNEETAFALDYFGVEAPRVVESAKAQGSEQVILTDHNEFQQSIADIREVEVYGVVDHHRVANFETANPLYMRVEPVGSASSIVYRMFKENGIEVPKAIAGMLLSGLISDTLLLKSPTTHVSDHLVAEELAELAEVNLEDYGMALLKAGTNLASKSEVELIGIDAKTFELNGNAVRVAQVNTVDIAEVLERQEAIEAAIKDAMAAEGYSDFVLMITDIVNSNSEILAIGANMDKVEAAFNFTLDNNHAFLAGAVSRKKQVVPQLTESFGA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pneumoniae (strain 70585)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.479 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAYGLDTEAVALGTPNEETAFVLNYFGVEAPRVITSAKAEGAEQVILTDHNEFQQSVSDIAEVEVYGVVDHHRVANFETASPLYMRLEPVGSASSIVYRMFKEHGVAVPKEIAGLMLSGLISDTLLLKSPTTHPTDKIIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAMQAANESNGYSDFVLMITDIVNSNSEILALGANMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTESFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pyogenes serotype M18 (strain MGAS8232)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.617 kDa
Sequence
MSKILVFGHQNPDTDAIASSYAFDYLSQKAFGLDTEVVALGTPNEETAFALDYFGVEAPRVVESAKAQGSEQVILTDHNEFQQSIADIREVEVYGVVDHHRVANFETANPLYMRVEPVGSASSIVYRMFKENGIEVPKAIAGMLLSGLISDTLLLKSPTTHVSDHLVAEELAELAEVNLEDYGMALLKAGTNLASKSEVELIGIDAKTFELNGNAVRVAQVNTVDIAEVLERQEAIEAAIKDAMAAEGYSDFVLMITDIVNSNSEILAIGANMDKVEAAFNFTLDNNHAFLAGAVSRKKQVVPQLTESFGA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pyogenes serotype M5 (strain Manfredo)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.617 kDa
Sequence
MSKILVFGHQNPDTDAIASSYAFDYLSQKAFGLDTEVVALGTPNEETAFALDYFGVEAPRVVESAKAQGSEQVILTDHNEFQQSIADIREVEVYGVVDHHRVANFETANPLYMRVEPVGSASSIVYRMFKENGIEVPKAIAGMLLSGLISDTLLLKSPTTHVSDHLVAEELAELAEVNLEDYGMALLKAGTNLASKSEVELIGIDAKTFELNGNAVRVAQVNTVDIAEVLERQEAIEAAIKDAMAAEGYSDFVLMITDIVNSNSEILAIGANMDKVEAAFNFTLDNNHAFLAGAVSRKKQVVPQLTESFGA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pneumoniae (strain Hungary19A-6)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.479 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAYGLDTEAVALGTPNEETAFVLNYFGVEAPRVITSAKAEGAEQVILTDHNEFQQSVSDIAEVEVYGVVDHHRVANFETASPLYMRLEPVGSASSIVYRMFKEHGVAVPKEIAGLMLSGLISDTLLLKSPTTHPTDKIIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAMQAANESNGYSDFVLMITDIVNSNSEILALGANMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTESFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.479 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAYGLDTEAVALGTPNEETAFVLNYFGVEAPRVITSAKAEGAEQVILTDHNEFQQSVSDIAEVEVYGVVDHHRVANFETASPLYMRLEPVGSASSIVYRMFKEHGVAVPKEIAGLMLSGLISDTLLLKSPTTHPTDKIIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAMQAANESNGYSDFVLMITDIVNSNSEILALGANMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTESFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.479 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAYGLDTEAVALGTPNEETAFVLNYFGVEAPRVITSAKAEGAEQVILTDHNEFQQSVSDIAEVEVYGVVDHHRVANFETASPLYMRLEPVGSASSIVYRMFKEHGVAVPKEIAGLMLSGLISDTLLLKSPTTHPTDKIIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAMQAANESNGYSDFVLMITDIVNSNSEILALGANMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTESFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pyogenes serotype M3 (strain SSI-1)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.617 kDa
Sequence
MSKILVFGHQNPDTDAIASSYAFDYLSQKAFGLDTEVVALGTPNEETAFALDYFGVEAPRVVESAKAQGSEQVILTDHNEFQQSIADIREVEVYGVVDHHRVANFETANPLYMRVEPVGSASSIVYRMFKENGIEVPKAIAGMLLSGLISDTLLLKSPTTHVSDHLVAEELAELAEVNLEDYGMALLKAGTNLASKSEVELIGIDAKTFELNGNAVRVAQVNTVDIAEVLERQEAIEAAIKDAMAAEGYSDFVLMITDIVNSNSEILAIGANMDKVEAAFNFTLDNNHAFLAGAVSRKKQVVPQLTESFGA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pneumoniae (strain CGSP14)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.479 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAYGLDTEAVALGTPNEETAFVLNYFGVEAPRVITSAKAEGAEQVILTDHNEFQQSVSDIAEVEVYGVVDHHRVANFETASPLYMRLEPVGSASSIVYRMFKEHGVAVPKEIAGLMLSGLISDTLLLKSPTTHPTDKIIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAMQAANESNGYSDFVLMITDIVNSNSEILALGANMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTESFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pyogenes serotype M49 (strain NZ131)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.633 kDa
Sequence
MSKILVFGHQNPDTDAIASSYAFDYLSQKAFGLDTEVVALGTPNEETAFALDYFGVEAPRVVESAKAQGSEQVILTDHNEFQQSIADIREVEVYGVVDHHRVANFETANPLYMRVEPVGSASSIVYRMFKENGIEVPKAIAGMLLSGLISDTLLLKSPTTHVSDHLVAEELAELAEVNLEDYGMALLKAGTNLASKSEVELIGIDAKTFELNGNAVRVAQVNTVDISEVLERQEAIEAAIKDAMAAEGYSDFVLMITDIVNSNSEILAIGANMDKVEAAFNFTLDNNHAFLAGAVSRKKQVVPQLTESFGA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.479 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAYGLDTEAVALGTPNEETAFVLNYFGVEAPRVITSAKAEGAEQVILTDHNEFQQSVSDIAEVEVYGVVDHHRVANFETASPLYMRLEPVGSASSIVYRMFKEHGVAVPKEIAGLMLSGLISDTLLLKSPTTHPTDKIIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAMQAANESNGYSDFVLMITDIVNSNSEILALGANMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTESFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus suis (strain 98HAH33)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.402 kDa
Sequence
MSKFLVFGHRNPDTDAIASSYGWAHLEREVFGRDAEAVVLGTPNEETAFALDYFGVTAPRVVESAKAEGVSQVILTDHNEFQQSIADIKEVEVAAVIDHHRVANFETANPLYMRLEPVGSASSIVYRAFKENGVIPPKEVAGLLLSGLISDTLLLKSPTTHVTDPQVAAELAEIAGVNLEEYGLALLKAGTNLASKSAEELIDIDAKTFGLNGNDVRVAQVNTVDIAEVLERQAEIEAAMTAASVANGYSDFVLMITDIVNSNSEILALGSNMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTDAFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus equi subsp. zooepidemicus (strain H70)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.695 kDa
Sequence
MSKILVFGHQNPDTDAIASSYAFDYLAKKAFDLDTEVVALGDPNEETAFALDYFGVSAPRVVTSAKAEGASHVILTDHNEFPQSISDIREVEVYGIVDHHRVANFETANPLYMRVEPVGSASSIVYRLFKENRVDVPKDIAGLLLSGLISDTLLLKSPTTHASDHRVAVELAELAGVKLEEYGMAMLKAGTNLASKSEAELIDIDAKTFELNGNAVRVAQVNTVDIAEVLERKEAIEAAIKEVMASEGYSDFVLMITDIVNSNSEILALGANMDKVEAAFSFKLEDNHAFLAGAVSRKKQVVPQLTESFGA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus sanguinis (strain SK36)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.523 kDa
Sequence
MSKILVFGHQNPDSDAIGSSYAFAYLAREAYGLDTEVVALGEPNEETAFVLDYFGVAAPRVITSAKAEGAEQVILTDHNEFQQSVADIAEVEVYGVVDHHRVANFETASPLYMRLEPVGSASSIVYRMFKEHGVEVPKEIAGLMLSGLISDTLLLKSPTTHPTDKVIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAIEKAIADNGYSDFVLMITDIINSNSEILAIGSNMDKVEAAFNFVLENNHAFLAGAVSRKKQVVPQLTASFSA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus suis (strain 05ZYH33)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.374 kDa
Sequence
MSKFLVFGHQNPDTDAIASSYGWAHLEREVFGRDAEAVVLGTPNEETAFALDYFGVTAPRVVESAKAEGVSQVILTDHNEFQQSIADIKEVEVAAVIDHHRVANFETANPLYMRLEPVGSASSIVYRAFKENGVIPPKEVAGLLLSGLISDTLLLKSPTTHVTDPQVAAELAEIAGVNLEEYGLALLKAGTNLASKSAEELIDIDAKTFGLNGNDVRVAQVNTVDIAEVLERQAEIEAAMTAASVANGYSDFVLMITDIVNSNSEILALGSNMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTDAFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.721 kDa
Sequence
MSKVLVFGHQNPDTDAIASSYAFAYLAKNAYKMDAEVVALGEPNEETAFALDYFGVTAPRVVESAKAEGVDTVILTDHNEFQQSLSDISDVTIFGVVDHHRVANFETANPLFMRVEPVGSASSIVYRMYKENNLEVPKEIAGLLLSGLISDTLLLKSPTTHMTDHKVAEELANLAGVNLDEYGMSLLKAGTNLASKSEAELIDIDAKTFELNGNAVRVAQVNTVDIAEVLERQDAIETAISDAIVKEGYSDFVLMITDIVNSNSEILALGSNMDKVEAAFNFKLENNHAFLPGAVSRKKQVVPQLTESFGA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pneumoniae (strain JJA)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.479 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAYGLDTEAVALGTPNEETAFVLNYFGVEAPRVITSAKAEGAEQVILTDHNEFQQSVSDIAEVEVYGVVDHHRVANFETASPLYMRLEPVGSASSIVYRMFKEHGVAVPKEIAGLMLSGLISDTLLLKSPTTHPTDKIIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAMQAANESNGYSDFVLMITDIVNSNSEILALGANMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTESFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pneumoniae (strain P1031)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.479 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAYGLDTEAVALGTPNEETAFVLNYFGVEAPRVITSAKAEGAEQVILTDHNEFQQSVSDIAEVEVYGVVDHHRVANFETASPLYMRLEPVGSASSIVYRMFKEHGVAVPKEIAGLMLSGLISDTLLLKSPTTHPTDKIIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAMQAANESNGYSDFVLMITDIVNSNSEILALGANMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTESFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus pneumoniae (strain Taiwan19F-14)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.479 kDa
Sequence
MSKILVFGHQNPDSDAIGSSVAFAYLAKEAYGLDTEAVALGTPNEETAFVLNYFGVEAPRVITSAKAEGAEQVILTDHNEFQQSVSDIAEVEVYGVVDHHRVANFETASPLYMRLEPVGSASSIVYRMFKEHGVAVPKEIAGLMLSGLISDTLLLKSPTTHPTDKIIAPELAELAGVNLEEYGLAMLKAGTNLASKSAEELIDIDAKTFELNGNNVRVAQVNTVDIAEVLERQAEIEAAMQAANESNGYSDFVLMITDIVNSNSEILALGANMDKVEAAFNFKLENNHAFLAGAVSRKKQVVPQLTESFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus clausii (strain KSM-K16)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.632 kDa
Sequence
MPKTLIFGHKNPDTDTICSAIAYADLKGQLGVETEAVRLGEPNGETLYALEAFGVSTPRLIEKAANETDRVILVDHNERQQSVSDIDDVQVVEVIDHHRIANFETADPVYYRAEPVGCTATIIKKLYKEHGLDIPKPIAGLMLSAIISDSLLFKSPTCTEEDRQAAKELAEIAGVNAEEYGLNMLKAGADISDKTAGELLTMDAKAFAMGAATVEIAQVNTVDINDVLARQSELEKVITAKINDNGLDLFVFIITDILENDSVALVLGDKTAAFEQAFQTTLTNHTAVLKGVVSRKKQVVPPLTEAIANVN

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.968 kDa
Sequence
MEKVLVFGHKNPDTDTIASAIAYAELKKELGVHAEAVRLGEVNGETQFALDYFKVARPRLVTEVSKEAQHVILVDHNERQQSADDIDAVKVTEVIDHHRIANFETSDPVYYRAEPVGCTTTILNKMYKEHGVAIKPEIAGLMLSAIVSDSLLFKSPTCTEQDVIAARELATIAGVDANVYGLDMLKAGADLSKKTIDELIALDAKEFSMGPFKVEIAQANTVDTAEVLLRQAELETRIEALIAEKDLNLYMLLVTDILTNNSVALVLGPEASLVERAFGLEATNHLLYLEGVVSRKKQVVPVLTNTAAAVE

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.485 kDa
Sequence
MEKEFVFGHQNPDTDAIGTAIAFSYLQNKLGYNTEAVALGEPNDETAYALKKFGFEAPRVIKEAAPEVDSVMLVDHNEPQQSVSDIDKVKVTHVVDHHRIMNFNTADPLYYRAEPVGCTSTIVWKMFNENDIEIPEKIAGIMLSAIISDTLLLKSPTTTDDDKEAVEALAKIAGVDYKDYGLAMLKAGTNINDKSEEELIDLDAKSFELNGHNVRVAQINVVDLPEALERKDAFLKAMEKASNDNDYDMFMLLITNILDSDSEALVVGSDETKSFFEKAFDKKLDDSEVKLPGVVSRKKQVVPPLTDAFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.282 kDa
Sequence
MEKELIFGHRNPDTDAIGTAIAYSYFQNQHGYNTEAVALGEANDETSFALKKFGFEAPRVVKTVANEVKAIMLVDHNEPQQSVEDRDQVKVTHVIDHHRISNFATIDPLFYRAEPVGCTSTVLWEMFKEQNMEIPANIAGIMLSAIISDTLLLKSPTTTDIDKEAVEELAKIAGVDYKEYGLELLKAGTNIAAKSVEELIDLDAKSFELGSKTARIAQVNVVDVPEALERKDAFLAAMEKDAKANGYDLFMLVITNVLDSDSEVLFIGDDESKSVFAKAFGKELVDSEAHLPGVVSRKKQIVPPLTRAFEA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.298 kDa
Sequence
MEKELIFGHRNPDTDAIGTAIAYSYFQNQHGYNTEAVALGEANDETSFALKKFGFEAPRVVKTVANEVKAIMLVDHNEPQQSVEDRDQVKVTHVIDHHRISNFATIDPLFYRAEPVGCTSTVLWEMFKEQNMEIPANIAGIMLSAIISDTLLLKSPTTTDIDKEAVEELAKIAGVDYKEYGLELLKAGTNIAAKSVEELIDLDAKSFELGSKTARIAQVNVVDVPEALERKDAFLAAMEKDAKANGYDLFMLVITNVLDSDSEVLFIGDDESKSVFAKAFGKELVDSEAHLLGVVSRKKQIVPPLTRAFEA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.221 kDa
Sequence
MAKELIFGHQNPDTDAIGTAIAYSYLQNKLGYDTEAVALGEANDETKYALNKFGFTAPRVIKTASNEVDAVMLVDHNEPQQSVSDIDKVKVTHVVDHHRIMNFNTADPLYYRAAPVGCTSTIMWQMYNEKEIEIPQDIAGIMLSAIISDTLLLKSPTTTDQDKEAVEALANIAGVNYKEYGLKMLKAGTNIADKSEEDLIDLDAKSFELNGSNVRVAQINVVDLPEALERKEAFLKAMDEASKSEGYDMFMLLITNILDSDSEALVVGSDESKAKFEKAFNTKLSDSEVKLPGVVSRKKQVVPPLTNAFEA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Lactobacillus helveticus (strain DPC 4571)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.349 kDa
Sequence
MEKEFVFGHQNPDTDAIGTAIAFSYLQNKLGYNTEAVALGEPNDETAYALKKFGFEAPRVIKKAAPEVNAVMLVDHNEPQQSVSDIDKVKVTHVVDHHRIMNFNTADPLYYRAEPMGCTSTIVWKMFNENGIEIPEKLAGLMLSAIISDTLLLKSPTTTDDDKKAVEALAKIANVDYKEYGLAMLKAGTNISDKSEEELIDLDAKSFALNGHNVRVAQINVVDLPEALERKDAFLKAMEASSNDNGYDMFMLLITNILDSDSEALVVGSDETKELFEKAFDKKLNDSEVKLPGVVSRKKQVVPPLTEAFEG

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.233 kDa
Sequence
MAKELIFGHQNPDTDAIGTAIAYSYLQNKLGYDTEAVALGEANDETKYALNKFGFTAPRVIKTASNEVDAVMLVDHNEPQQSVSDIDKVKVTHVVDHHRIMNFNTADPLYYRAAPVGCTSTIMWQMYNEKEIEIPQDIAGIMLSAIISDTLLLKSPTTTDQDKEAVVSLANIAGVDYKEYGLKMLKAGTNIADKSEEDLIDLDAKSFELNGSNVRVAQINVVDLPEALERKDAFLKAMDEASKREGYDMFMLLITNILDSDSEALVVGSDESKAKFEKAFNAKLSDSEVKLPGVVSRKKQVVPPLTNAFEA

Gene
ppaC
Protein
Manganese-dependent inorganic pyrophosphatase
Organism
Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
Length
311 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.963 kDa
Sequence
MADNIYVVGHKSPDTDSVTSAITYANLKNQLGMKDVVPAAAGEINNETKYVLEYFKIAPPVVLNDATDKKVILVDHNEVGQAVDNIMKADILEIIDHHKIGDIQTGKPIFFHNEPVGATGTIIASMYELNGVAISKEMAGLMMAAILSDTVLFKSPTCTDKDKATVEKLSKICGEDPQKFGMEMLKAKSDIKSKTAKDILFGDFKKFDFSGVKAGVGQIEVMDLADLAPKREEILAEMRKALESEKLDMIVLMLTDVIKEASDLLFVGTAAAKEGFEKAFGGKVTNNSIYKEKVLSRKKQVIPPLESAFKK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Length
310 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.821 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDYFKVEGPRFVETVANEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPLYYRCEPVGCTATILNKMYKENGVAIRKEIAGLMLSAIISDSLLFKSPTCTEQDVAAARELAEIAGVDAESYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGKAANAVEKAYNVTLENNTATLKGVVSRKKQIVPVLTETFQAL

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Length
310 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.403 kDa
Sequence
MSKILVFGHQNPDSDAIGSSMAYAYLKRQLGVDAQAVALGNPNEETAFVLDYFGIQAPPVVKSAQAEGAKQVILTDHNEFQQSIADIREVEVVEVVDHHRVANFETANPLYMRLEPVGSASSIVYRLYKENGVAIPKEIAGVMLSGLISDTLLLKSPTTHASDPAVAEDLAKIAGVDLQEYGLAMLKAGTNLASKTAAQLVDIDAKTFELNGSQVRVAQVNTVDINEVLERQNEIEEAIKASQAANGYSDFVLMITDILNSNSEILALGNNTDKVEAAFNFTLKNNHAFLAGAVSRKKQVVPQLTESFNG

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus thermophilus (strain CNRZ 1066)
Length
310 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.81 kDa
Sequence
MSKIFVFGHQNPDSDAIGSSYGYAYLKRQLGVEAEAVALGTPNEETAFVLDYFSVNAPRVVESAQSEGVNQVILTDHNEFQQSISDIKDVEVIEVVDHHRVANFETANPLMMRLEPVGSASSIVYRMFKENNVEIPKDVAGLLLSGLISDTLLLKSPTTHASDPAVAEELARLAGVNLEEYGLAMLKAGTNLSSKSAEELIDIDAKTFELNGNQVRVAQVNTVDISDVLSRQAEIEEAINSSIKSNGYSDFVLMITDILNSNSEILALGSNTDKIEKAFNFVLENNHAFLKGAVSRKKQVVPQLTESFNV

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Length
310 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.81 kDa
Sequence
MSKIFVFGHQNPDSDAIGSSYGYAYLKRQLGVEAEAVALGTPNEETAFVLDYFSVNAPRVVESAQSEGVNQVILTDHNEFQQSISDIKDVEVIEVVDHHRVANFETANPLMMRLEPVGSASSIVYRMFKENNVEIPKDVAGLLLSGLISDTLLLKSPTTHASDPAVAEELARLAGVNLEEYGLAMLKAGTNLSSKSAEELIDIDAKTFELNGNQVRVAQVNTVDISDVLSRQAEIEEAINSSIKSNGYSDFVLMITDILNSNSEILALGSNTDKIEKAFNFVLENNHAFLKGAVSRKKQVVPQLTESFNV

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Length
310 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.838 kDa
Sequence
MSKIFVFGHQNPDSDAIGSSYGYAYLKRQLGVEAEAVALGTPNEETAFVLDYFSVNAPRVVESARSEGVNQVILTDHNEFQQSISDIKDVEVIEVVDHHRVANFETANPLMMRLEPVGSASSIVYRMFKENNVEIPKDVAGLLLSGLISDTLLLKSPTTHASDPAVAEELARLAGVNLEEYGLAMLKAGTNLSSKSAEELIDIDAKTFELNGNQVRVAQVNTVDISDVLSRQAEIEEAINSSIKSNGYSDFVLMITDILNSNSEILALGSNTDKIEKAFNFVLENNHAFLKGAVSRKKQVVPQLTESFNV

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Length
310 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.783 kDa
Sequence
MEKKLIFGHKNPDTDSICSALVYADLKTKLGANVEPVRLGVISSETAFVLNYFQVKEPRLVETVANEVNEVILVDHNERQQSANDIEQVQVVEVIDHHRIANFETSNPLYFRAEPVGCTTTILKKMYKENGVDIPKEMAGLMLSAIISDTLLLKSPTCTEQDVAAAHELAEIAGVNLEAYGLDMLKAGADLSDKTIEQLLTLDAKEFQMGNAKVEIAQVNAVDVNDVLARQGELEAAMNASIAEKALDLFVFVVTDILNNDSVAIALGSATQAVEKAYQVTLVDNKAVLKGVVSRKKQIVPVLTDTFQAL

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)
Length
310 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.525 kDa
Sequence
MEDIIYITGHKNPDTDSICSAIAYSELKNKLGFNTVPGRLGNISRETEFALNYFKANAPKLLENLSSNQDIIIVDHNERAQSVDNLEDLHLLEIIDHHRIADIQTSYPIFFRNEPVGCSSTIIGSMYFEKGIEPSKRAAGLMCSAIISDTLLFRSPTTTARDKEVLKKLAKIADIDPEKYASEMFKAGTSLKGKTVEEIFNSDYKAFNLGDKKIGVSQVTTMDIEGFDEYKKDMLAYMNKKVKDENFNAVLLLLTDIIKEGSLIIATGENTDLVNKAFNVELKDNAVYVPGILSRKKQVIPPLTSAIEGK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus anthracis (strain A0248)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.748 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDYFKVEGPRFVETVANEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGVTIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAEIAGVDADKYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGKAANIVEKAYNVSLENNTATLKGVVSRKKQIVPVLTEAFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus anthracis (strain CDC 684 / NRRL 3495)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.748 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDYFKVEGPRFVETVANEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGVTIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAEIAGVDADKYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGKAANIVEKAYNVSLENNTATLKGVVSRKKQIVPVLTEAFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus anthracis
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.748 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDYFKVEGPRFVETVANEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGVTIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAEIAGVDADKYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGKAANIVEKAYNVSLENNTATLKGVVSRKKQIVPVLTEAFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus cereus (strain AH820)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.748 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDYFKVEGPRFVETVANEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGVTIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAEIAGVDADKYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGKAANIVEKAYNVSLENNTATLKGVVSRKKQIVPVLTEAFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus cereus (strain ATCC 10987 / NRS 248)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.72 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDYFKVEGPRFVETVANEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGITIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAEIAGVDADNYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGNAANVVEKAYNVSLENNTATLKGVVSRKKQIVPVLTEAFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus cereus (strain G9842)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.666 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDYFKVEGPRFVETVASEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGVTIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAEIAGVDADSYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGKAANVVEKAYNVSLENNTATLKGVVSRKKQIVPVLTEAFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus cereus (strain 03BB102)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.788 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDYFKVEGPRFVETVANEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGVTIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAEIADVDADNYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGKAANVVEKAYNVPLENNTATLKGVVSRKKQIVPVLTEAFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus cereus (strain B4264)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.692 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDYFKVEGPRFVETVASEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGVTIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAQIAGVDADNYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGKAANVVEKAYNVSLENNTATLKGVVSRKKQIVPVLTEAFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus cereus (strain AH187)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.763 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDYFKVEGPRFVETVANEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGITIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAEIAGVDADKYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGKAANIVEKAYNVSLENNTATLKGVVSRKKQIVPVLTEAFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus cereus (strain Q1)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.721 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDYFKVEGPRFVETVASEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGITIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAEIAGVDADKYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGKAANVVEKAYNVSLENNTATLKGVVSRKKQIVPVLTEAFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus aureus (strain Mu3 / ATCC 700698)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus aureus (strain JH1)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus aureus (strain USA300)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus aureus (strain NCTC 8325)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus aureus (strain JH9)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus aureus (strain bovine RF122 / ET3-1)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus aureus (strain COL)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus aureus (strain Mu50 / ATCC 700699)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus aureus (strain N315)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus aureus (strain MRSA252)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus aureus (strain MSSA476)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus aureus (strain USA300 / TCH1516)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus aureus (strain MW2)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.069 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMAEFEQLRGNSGAKAYRLGDVSAETQFALDTFNVPAPELLTDDLDGQDVILVDHNEFQQSSDTIASATIKHVIDHHRIANFETAGPLCYRAEPVGCTATILYKMFRERGFEIKPEIAGLMLSAIISDSLLFKSPTCTQQDVKAAEELKDIAKVDIQKYGLDMLKAGASTTDKSVEFLLNMDAKSFTMGDYVTRIAQVNAVDLDEVLNRKEDLEKEMLAVSAQEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFNVQLEDDMAFLSGVVSRKKQIVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus epidermidis (strain ATCC 35984 / RP62A)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.207 kDa
Sequence
MTKTFIFGHKNPDTDAISSALIMADFEQQTGNTEAKAYRLGEISAETQFALDHFNVEAPELLNEDLKGQDVILVDHNEFQQSADTISNATIKHVIDHHRISNFETAGPLYYRAEPVGCSATILYKMYKERGFEIKPEIAGLMISAIISDSLLFKSPTCTKEDVDAAQALKDIANVDLEAYGLEMLKAGASTTDKSAETLVNMDAKSFNMGDYVTRIAQVNTVDIDEVLDRKEEFEKVMLEMSANEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFKVQLDDGMAFLSGVVSRKKQVVPQITEVLTQ

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus epidermidis (strain ATCC 12228)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.233 kDa
Sequence
MTKTFIFGHKNPDTDAISSALIMADFEQQTGNTEAKAYRLGEISAETQFALDYFNVEAPELLNEDLKGQDVILVDHNEFQQSADTISNATIKHVIDHHRISNFETAGPLYYRAEPVGCSATILYKMYKERGFEIKPEIAGLMISAIISDSLLFKSPTCTKEDVDAAQALKDIANVDLEAYGLEMLKAGASTTDKSAETLVNMDAKSFNMGDYVTRIAQVNTVDIDEVLDRKEEFEKVMLEMSANEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFKVQLDDGMAFLSGVVSRKKQVVPQITEVLTQ

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus haemolyticus (strain JCSC1435)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.255 kDa
Sequence
MAKTYIFGHQNPDTDAIASAIIMADFEQLTGNSEATPYRLGDINPETKFALDHFEVKAPELLSDNLDGREVILVDHNEFQQSAETISDAEIKHVVDHHRIANFETASPLWYRAEPVGCTATILYKMYKERGFEIKPHIAGLMISAIISDSLLFKSPTCTDEDVNAAKDLKDLANVDLDEYGLEMLKAGASTTDKSAEELLDMDAKSFNMGDYVTRIAQVNTVDIDEVLNRKEDLEKAMLETSANEKYDLFVLVVTDIINSDSKILVVGAEKDKVGEAFKVQLDDGMAFLSGVVSRKKQVVPQITDALIK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.893 kDa
Sequence
MAKTYIFGHKNPDTDAISSAIIMADFEQQTGNAEATAYRLGEVGPETQYALDHFNVTAPELLNDDLADQNVILVDHNEFQQSADSIADAAVQHVVDHHRIANFETAAPLYYRAEPVGCTATILYKMYKERGFEIKPEIAGLMISAIISDSLLFKSPTCTEQDVQAAEALKSIANVDLESYGLEMLKAGASTKDKSVSDILSMDAKSFNMGDFVTRIGQVNTVDIDEVFARQEELEKEMLEVSANEKYDLFVLVVTDIINSDSKILVVGAEKDKVGVAFNVTLDNNTAFLPGVVSRKKQVVPQITEALTK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.692 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDYFKVEGPRFVETVASEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGVTIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAQIAGVDADNYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGKAANVVEKAYNVSLENNTATLKGVVSRKKQIVPVLTEAFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus cereus (strain ZK / E33L)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.748 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALNYFKVEGPRFVETVANEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGVTIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAEIAGVDADKYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGKAANIVEKAYNVSLENNTATLKGVVSRKKQIVPVLTEAFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus thuringiensis subsp. konkukian (strain 97-27)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.748 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDYFKVEGPRFVETVANEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGVTIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAEIAGVDADKYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVISAVVEEKGLDLFLFVVTDILTNDSVGLAIGKAANIVEKAYNVSLENNTATLKGVVSRKKQIVPVLTEAFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.46 kDa
Sequence
MSKVLIFGHKNPDTDTICSAIAYAELKKELGMDAEPVRLGEINGETEYALKKFNAEVPRLVNTVANETDSVILVDHNERQQSVDDLDQVRVLEVIDHHRIANFETSDPLYYRAEPVGCTATILNKLYKENGVEIKKDIAGLMLSAIISDSLLFKSPTCTEEDVKAAKELAAIAGVDADSYGLDMLKAGADLSAKTIPQLLSLDAKEFTMGSHKVEIAQVNTVDTNDVLSRKEEVDAELAKAVSEKGLDLFVFVVTDILTNDSVVVASGQAAQAVEKAFNVTLADNTATLKGVVSRKKQIVPPLTEALKG

Gene
ppaC
Protein
Manganese-dependent inorganic pyrophosphatase
Organism
Bacillus subtilis (strain 168)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.989 kDa
Sequence
MEKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEEVQVLEVIDHHRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTDQDVAAAKELAEIAGVDAEEYGLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQAELEAVISKVVAEKNLDLFLLVITDILENDSLALAIGNEAAKVEKAFNVTLENNTALLKGVVSRKKQVVPVLTDAMAE

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.013 kDa
Sequence
MEKILIFGHQNPDTDTICSAIAYADLKNKLGFNAEPVRLGQVNGETQYALDYFKQESPRLVETAANEVNGVILVDHNERQQSIKDIEDVQVLEVIDHHRIANFETAEPLYYRAEPVGCTATILNKMYKENNVKIEKEIAGLMLSAIISDSLLFKSPTCTEQDIAAAKELAEIAGVDAEEYGLNMLKAGADLSKKTVEELISLDAKEFTLGSKKVEIAQVNTVDIEDVKKRQPELEAALSKVIAEKNLDLFLLVITDILENDSLALAIGDQASKVEKAFNVTLENNTALLKGVVSRKKQVVPVLTDAIAE

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus weihenstephanensis (strain KBAB4)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.734 kDa
Sequence
MEKVLVFGHKNPDTDAICSAIAYAELKKELGMNAEPVRLGEISGETQFALDSFKVEGPRFVETVANEVDNVILVDHNERQQSANDIESVRVLEVIDHHRIANFETSDPIYYRCEPVGCTATILNKMYKENGVTIRKEVAGLMLSAIISDSLLFKSPTCTEQDVAAARELAEIAGVDADSYGLEMLKAGADLSGKTMEQLISLDAKEFQMGNAKVEIAQVNAVDTNDVLVHQAELEKVITTVVEEKGLDLFLFVVTDILTNDSVGLAIGKATNVVEKAYNVTLQNNTATLKGVVSRKKQIVPVLTETFQA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.634 kDa
Sequence
MSTVLVFGHKNPDTDTITSALAYAELKKKLGMDAEAVRLGEVNGETQYALDHFRVKAPRLIESVKGEAEEVILVDHNEFQQSADGIEDVRILEVIDHHRIANFQTADPLYYRAEPVGCTATILLKLYKEHGVEIAADMAGLMLSAIISDSLLFKSPTCTDEDIKAAKELAEIAGVDAETYGLEMLKAGADLSQKTIEELISLDAKEFAMGDYRVEIAQVNTVDANDVLNRKAEVEAAIANTVAAKNLDLFVFAITNILTNDSEAIVVGPKPELFEQAFNVTLQNGLATLPGVVSRKKQIVPFLTEAATK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Length
309 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.62 kDa
Sequence
MSKELVFGHQNPDTDAIVAAKAFSYYENKMGADTEAVALGEPNEETQFVLDYFDEPALRVITKASDEVDSVMLVDHNEPQQSVSDIADVTVSHVVDHHRIAGFDTAQPLFYRAEPLGCCSTVIYKLFKENDIEIPAKLAGLMLSAIISDTLLLKSPTTTETDVAVVKDLAKIADIDYETYGLAMLKAGTNLDSKTEKELIDADAKSFEMAGKTVRVAQINTVDLDDVFKRQAALEAAAKDENASDGYDLFLILATNILDSNSELLVVGNPTEPVEKAFGKTIANNRLSLPGVVSRKKQVVPQLTDAFNA

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Staphylococcus carnosus (strain TM300)
Length
308 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.768 kDa
Sequence
MESTYIFGHKSPDTDAINSAIIMAEFEKLNGNDSAKAYRLGKVNPETQYALDYFKAEAPELLTEDLTDKDVILVDHNEFQQSADTIESAKIRHVVDHHRIANFHTAAPLYYRAEPLGCTATILYKMFKEQGFEIKPQIASLMLSAIISDSLLFKSPTCTEQDKAAAQALENIAGVDAQEYGLEMLKAGASTVDKSPVEIINADAKTFNMGDYSVRIGQVNTVDVNEILARQAELEQAITETLSGAEYDIFVLVATDILNSDSTILVLGKDKDKIAKAFDVELDNNTAFLPGVVSRKKQIVPPITAALS

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Bacillus pumilus (strain SAFR-032)
Length
308 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.551 kDa
Sequence
MGKTLVFGHKNPDTDTICSAIAYADLKNKIGVEAEAVRLGEINGETQFALDFFKQEAPRFIETAANETKQVILVDHNEFQQSVSDIDQVQVTEVIDHHRIANFETSEPLYYRAEPVGCTATILNKMYKENQVKIEKEIAGLLLSAIISDSLLFKSPTCTQQDIDAAHELAEIAGVDPEVYGLDMLKAGADLSQKTVQELITIDAKEFALGNSKVEIAQVNTVDIAEVTARQTDIEAKINEVIAAKGLDLFVLVITDILENDSLALALGAEAAKVEKAFHVTLENNTALLKGVVSRKKQVVPALTDALS

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Enterococcus faecalis (strain ATCC 700802 / V583)
Length
308 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.483 kDa
Sequence
MSKILVFGHQNPDTDAIGAAISFAYLQKELGKETEAVALGTPSEETQYALDYFNIEAPRVVTEAASETNQVMLVDHNEFQQSISDIAEVNILAVVDHHRIANFETADPLYYRAEPVGCTSTIIYKMFKENNVTIPAQIAGMMVSAIISDTLLFKSPTCTQEDIDAAHALADIAEINLEGYGLDLLKAGTNLSDKSAEVLLDLDAKSFPMNGKTVRVAQVNTVDLAEVLDRQAELEAAMAAENAANNYDLFVLIITNILDSDSELLAIGAEQAKIEAAFNVTLVNNRAFLPGVVSRKKQVVPQLTEVFN

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Length
308 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.645 kDa
Sequence
MTKTLVFGHKNPDTDTICSAISYAELKKAQGADIEAVRLGELNSETAFVLDYFQVTAPRLVETVANEVSEVALVDHNERQQSVDDIDDVTVVAVVDHHRIANFETSDPLYYRAEPVGCTTTILLKMFRENEVEVSKTVAGLMLSAIISDTLLFQSPTCTEEDKVAAEKLALIADVDIQAYGMEMLKAGADVSKKTVAELLLDAKEFNMNGSKVEIAQINVVDVNDVLSRRAEVEALMTQNIVDKGLDLYLFVITNILTNDSVGIAIGSKTAVVEEAYGVKFVENQAPLKGVVSRKKQVVPILTDTFAK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Listeria monocytogenes serotype 4b (strain CLIP80459)
Length
308 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.761 kDa
Sequence
MTKTLVFGHKNPDTDTICSAISYAELKKAQGADIEAVRLGELNSETAFVLDYFQVTAPRLVQTVANEVSEVALVDHNERQQSVDDIDDVTVTAVVDHHRIANFETSDPLYYRAEPVGCTTTILLKMFRENEVEVSKTVAGLMLSAIISDTLLFQSPTCTEEDKVAAQKLAQIADVDIQSYGMEMLKAGADVSKKTVAELLLDAKEFNMNDNKVEIAQINVVDVNDVLSRRAEVEALMTQNIVDKGLDLYLFVITNILTNDSVGIAIGSKTAVVEEAYGVKFVENQAPLKGVVSRKKQVVPILTDTFAK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Listeria monocytogenes serotype 4b (strain F2365)
Length
308 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.76 kDa
Sequence
MTKTLVFGHKNPDTDTICSAISYAELKKAQGADIEAVRLGELNSETAFVLDYFQVTAPRLVQTVANEVSEVALVDHNERQQSVDDIDDVTVTAVVDHHRIANFETSDPLYYRAEPVGCTTTILLKMFRENEVEVSKTVAGLMLSAIISDTLLFQSPTCTQEDKVAAQKLAQIADVDIQSYGMEMLKAGADVSKKTVAELLLDAKEFNMNDNKVEIAQINVVDVNDVLSRRAEVEALMTQNIVDKGLDLYLFVITNILTNDSVGIAIGSKTAVVEEAYGVKFVENQAPLKGVVSRKKQVVPILTDTFAK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Listeria monocytogenes serotype 4a (strain HCC23)
Length
308 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.775 kDa
Sequence
MTKTLVFGHKNPDTDTICSAISYAELKKAQGADIEAVRLGELNSETAFVLDYFQVTAPRLVQTVANEVSEVALVDHNERQQSVDDIDDVTVTAVVDHHRIANFETSDPLYYRAEPVGCTTTILLKMFRENEVEVSKTVAGLMLSAIISDTLLFQSPTCTEEDKVAAQKLAQIADVEIQSYGMEMLKAGADVSKKTVAELLLDAKEFNMNDNKVEIAQINVVDVNDVLSRRAEVEALMTQNIVDKGLDLYLFVITNILTNDSVGIAIGSKTAVVEEAYGVKFVENQAPLKGVVSRKKQVVPILTDTFAK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Length
308 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.761 kDa
Sequence
MTKTLVFGHKNPDTDTICSAISYAELKKAQGADIEAVRLGELNSETAFVLDYFQVTAPRLVQTVANEVSEVALVDHNERQQSVDDIDDVTVTAVVDHHRIANFETSDPLYYRAEPVGCTTTILLKMFRENEVEVSKTVAGLMLSAIISDTLLFQSPTCTEEDKVAAQKLAQIADVDIQSYGMEMLKAGADVSKKTVAELLLDAKEFNMNDNKVEIAQINVVDVNDVLSRRAEVEALMTQNIVDKGLDLYLFVITNILTNDSVGIAIGSKTAVVEEAYGVKFVENQAPLKGVVSRKKQVVPILTDTFAK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334)
Length
308 amino acids
Similarity
Belongs to the PPase class C family.
Mass
33.779 kDa
Sequence
MTKTLVFGHKNPDTDTICSAISYAELKKAQGADIEAVRLGELNSETTFVLDYFQATAPRLVQTVANEVSEVALVDHNERQQSANDIDEVTVTAVVDHHRIANFETSDPLYYRAEPVGCTTTILLKMFRENEVEISKTVAGLMLSAIISDTLLFQSPTCTEEDKVAAEKLAVIADVDIQTYGMEMLKAGADVSKKTVAELLLDAKEFNMNGNKVEIAQINVVDVNDVLNRRSEVEALMTQNVVDKGLDLYLFVITNILTNDSIGISIGSKTSVVEEAYGIKFVENQAPLKGVVSRKKQVVPILTDTFAK

Gene
ppaC
Protein
Probable manganese-dependent inorganic pyrophosphatase
Organism
Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Length
308 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.054 kDa
Sequence
MVKTVIFGHKNPDTDTICSSIAYADLKTKLGHEVAPVRLGEVNLETQFALDKFNIHAPELIERVEDGAEVILVDHNEFQQSVDNIENATIREVIDHHRISNFETKEPLYFRAEPVGCTATILNKMYKENDISVDKNIAGILLSAIISDSLLLKSPTCTEEDVQAAHELAEIAGVDLESYGLDMLKAGADLSDKTVKDLITMDAKEFAMGNAKVEIAQVNAVDTNEIYKLHDKLVEVITSRINDNDLDLFLFVVTDILNNDSEVLAIGNGKDKVNAAFNVTLDSTNRALLKGVVSRKKQIVTVLTEQFK

Gene
ppaC
Protein
Manganese-dependent inorganic pyrophosphatase
Organism
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Length
307 amino acids
Similarity
Belongs to the PPase class C family.
Mass
34.113 kDa
Sequence
MRYVVGHKNPDTDSIASAIVLAYFLDCYPARLGDINPETEFVLRKFGVMEPELIESAKGKEIILVDHSEKSQSFDDLEEGKLIAIIDHHKVGLTTTEPILYYAKPVGSTATVIAELYFKDAIDLIGGKKKELKPDLAGLLLSAIISDTVLFKSPTTTDLDKEMAKKLAEIAGISNIEEFGMEILKAKSVVGKLKPEEIINMDFKNFDFNGKKVGIGQVEVIDVSEVESKKEDIYKLLEEKLKNEGYDLIVFLITDIMKEGSEALVVGNKEMFEKAFNVKVEGNSVFLEGVMSRKKQVVPPLERAYNG

Gene
ppaC
Protein
Manganese-dependent inorganic pyrophosphatase
Organism
Bacillus megaterium
Length
16 amino acids
Similarity
Belongs to the PPase class C family.
Mass
1.828 kDa
Fragment
single
Sequence
QKTLIFGHKNPDTDTI