About Services Plasmids Contact

pou3f4-a

Gene
pou3f4-a
Protein
POU domain, class 3, transcription factor 4-A
Organism
Xenopus laevis
Length
361 amino acids
Function
Transcriptional activator. Induces neural-specific gene expression to act as a key regulator of neural differentiation.
Similarity
Belongs to the POU transcription factor family. Class-3 subfamily.
Mass
39.838 kDa
Sequence
MATAASNPYSILSSSSLVHADSAVMQQGSPFRNPQKLLQSDYLQGVPCNGHPLGHHWVTSLSDANPWSSSLASSPLDQQDIKPGREDLQLGAIIHHRSPHVNHHSPHTNHPNAWGASPAHNSSLTSSGQPINIYSQPSFTVSGMLDHGELTPPLPAGTTQSLHPVLREPNDHVDLGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSTGNPTSIDKIAAQGRKRKKRTSIEVSVKGVLETHFLKCPKPAALEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDPQQHEVYSHSVKTDTSCNEL