About Services Plasmids Contact

pou3f1

Gene
POU3F1
Protein
POU domain, class 3, transcription factor 1
Organism
Homo sapiens
Length
451 amino acids
Function
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Thought to be involved in early embryogenesis and neurogenesis.
Similarity
Belongs to the POU transcription factor family. Class-3 subfamily.
Mass
45.496 kDa
Sequence
MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQGAAHAGAAWAQGSTAHHLGPAMSPSPGASGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPGGGGASPPSAPPPPPPAALHHHHHHTLPGSVQ

Gene
Pou3f1
Protein
POU domain, class 3, transcription factor 1
Organism
Rattus norvegicus
Length
451 amino acids
Function
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Thought to be involved in early embryogenesis and neurogenesis. Both in normal development and in response to nerve transection, SCIP expression was transiently activated only during the period of rapid cell division that separates the premyelinating and myelinating phases of Schwann cell differentiation. In cotransfection assays, scip acted as a transcriptional repressor of myelin specific genes.
Similarity
Belongs to the POU transcription factor family. Class-3 subfamily.
Mass
45.496 kDa
Sequence
MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGSTGRADDGGGGGGFHARLVHQGAAHAGAAWAQGGTAHHLGPAMSPSPGAGGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPGGGSASPPSAPPPPPPAALHHHHHHTLPGSVQ

Gene
Pou3f1
Protein
POU domain, class 3, transcription factor 1
Organism
Mus musculus
Length
449 amino acids
Function
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Thought to be involved in early embryogenesis and neurogenesis.
Similarity
Belongs to the POU transcription factor family. Class-3 subfamily.
Mass
45.324 kDa
Sequence
MATTAQYLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEWLGAGAGHPVGLAHPQWLPTGGGGGGDWAGGPHLEHGKAGGGGTGRADDGGGGGGFHARLVHQGAAHAGAAWAQGGTAHHLGPAMSPSPGAGGGHQPQPLGLYAQAAYPGGGGGGLAGMLAAGGGGAGPGLHHALHEDGHEAQLEPSPPPHLGAHGHAHGHAHAGGLHAAAAHLHPGAGGGGSSVGEHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSSSGSPTNLDKIAAQGRKRKKRTSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDDVYAPGELGPGGGSASPPSAPPPPPPAALHHHHHHTLPGSVQ

Gene
pou3f1
Protein
POU domain, class 3, transcription factor 1
Organism
Xenopus tropicalis
Length
375 amino acids
Function
May play a role in neuronal differentiation.
Similarity
Belongs to the POU transcription factor family. Class-3 subfamily.
Mass
41.846 kDa
Sequence
MAATAQYLPRNNSLPSNPLMHPDSDRMHQGTTYREVQKMMHQEYLQGLATNAGHPMSLTHHQWLPNPASDWGSGSHLGAQAEHGKSGVQSSREDLSSSFHHHRSHLVHQQTPSSHAWAQSGGHHLPPMSPGSNSHQPLIYSQSSYTNLNGMLGPQASSLHHSMRDPLHDDPGVLDTHVESPPQHLSHHQDHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSTTGSPTNLDKIAAQGRKRKKRTSIEVGVKGALENHFLKCPKPSAHEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPAGVPHPPMEDVYSQAETPPLHHTLQTSVQ

Gene
pou3f1
Protein
POU domain, class 3, transcription factor 1
Organism
Danio rerio
Length
368 amino acids
Function
Transcription factor that may play important roles in patterning the embryonic brain. Could directly respond to the reception of the sonic hedgehog (shh) signal.
Similarity
Belongs to the POU transcription factor family. Class-3 subfamily.
Mass
41.433 kDa
Sequence
MATTAQYIPRNNSLPSNPLMHPDSDRMHQGTTYREVQKMMHHEYLQGLATNTGHPMSLTHHQWLPTSNTDWTSGTHIGQAEHNKASVQSREDLGNGYHRSHLVHQPTQNSHHGSWAPTTTHHLSPLSPASNGHQSLVYSQTGYTMLSPQPSLHHGLRDPLHDDAGSHDNQMESPQQPFSHHQDHSDEDAPSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEETDSNTGSPTNLDKIAAQGRKRKKRTSIEVGVKGALENHFLKCPKPSAHEITTLAGTLQLEKEVVRVWFCNRRQKEKRMTPVGVPHPTMEDVYSQAETPPLHHTLQSPVQ