About Services Plasmids Contact

porG

Gene
porG
Protein
Pyruvate/ketoisovalerate oxidoreductases common subunit gamma
Organism
Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Length
185 amino acids
Mass
20.021 kDa
Sequence
MIEVRFHGRGGQGAVTAANILAEAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDNKPIRIKTQIYEPDVVVVLDPSLLDAVDVTAGLKDEGIVIVNTEKSKEEVLEKLKKKPKKLAIVDATTIALEILGLPITNTAILGAVAKATGLVKIESIEEAIKDTFSGELGEKNARAAREAYEKTEVFEL

Gene
porG
Protein
Pyruvate/ketoisovalerate oxidoreductases common subunit gamma
Organism
Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Length
185 amino acids
Mass
20.051 kDa
Sequence
MIEIRFHGRGGQGAVTAANILAEAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRIKTQIYEPDIVVVLDPSLLETVDVTAGLKEEGIVIINTEKSKDEILEKLKKKPKKLALVDATTIALETLGLPITNTAILGAVAKATGLVNIESVEKAIKDTFSGELGEKNAKAAREAFEKTEIFEV

Gene
porG
Protein
Pyruvate/ketoisovalerate oxidoreductases common subunit gamma
Organism
Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Length
185 amino acids
Mass
19.693 kDa
Sequence
MIEIRFHGRGGQGAVTAANILASAAFKEGKYVQAFPFFGVERRGAPVTAFTRIDDKPIRIKTQIYEPDVVVVLDPSLLDTVDVTAGLKDGGIVIVNTEKSKEEVLEKLKKKPGKLALVDATGIALEILGLPITNTAILGAVAKATGLVKLESVQEAIKETFSGALGEKNAKAAEEAFNKTVVYEL

Gene
porG
Protein
Pyruvate/ketoisovalerate oxidoreductases common subunit gamma
Organism
Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Length
185 amino acids
Mass
19.926 kDa
Sequence
MIEIRFHGRGGQGAVTAANILAEAAFLEGKYVQAFPFFGVERRGAPVTAFTRIDDKPIRIKTQIYEPDVVVVLDPSLLDTVDVTAGLKEGGMVIVNTEKTKEEVLEKLKKKPAKLALVDATTIALEILGLPITNTSILGAVAKATGIVKIESVEEAIKDTFSGELGKKNAKAAREAFEKTVVYEL

Gene
porG
Protein
Pyruvate/ketoisovalerate oxidoreductases common subunit gamma
Organism
Pyrococcus abyssi (strain GE5 / Orsay)
Length
185 amino acids
Mass
20.023 kDa
Sequence
MIEIRFHGRGGQGAVTAANILAEAAFIEGKYVQAFPFFGVERRGAPVTAFTRIDEKPIRIKTQIYEPDVVVVLDPSLLETVDVTAGLKEDGIVIVNTEKSKEEVLEKLKRKPKKLALVDATTIALETLGLPITNTAILGAVAKATGLVKIESVETAIKDTFSGELGEKNAKAAREAFEKTQIFEV

Gene
porG
Protein
Pyruvate/ketoisovalerate oxidoreductases common subunit gamma
Organism
Pyrococcus endeavori
Length
15 amino acids
Mass
1.628 kDa
Fragment
single
Sequence
MIEIRFHGRGGQGAV