About Services Plasmids Contact

pop8

Gene
POP8
Protein
Ribonucleases P/MRP protein subunit POP8
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
133 amino acids
Function
Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP, which cleaves pre-rRNA sequences.
Mass
15.512 kDa
Sequence
MGKKTFREWQYFKLSITSFDQDVDDAHAIDQMTWRQWLNNALKRSYGIFGEGVEYSFLHVDDKLAYIRVNHADKDTFSSSISTYISTDELVGSPLTVSILQESSSLRLLEVTDDDRLWLKKVMEEEEQDCKCI

Gene
pop8
Protein
Probable ribonucleases P protein subunit pop8
Organism
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
108 amino acids
Function
Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends.
Mass
12.379 kDa
Sequence
MVLHQRLKSEWSYIILEVVGGTTPIDEIDDISLRHLITLALNQSFGIFGSAIPIDFLHRQSKFLYLRCHKEDKKKVLVALGSYVREPEQIRLMVLHASDFPCQAVPFS