About Services Plasmids Contact

pop3

Gene
pop3
Protein
Target of rapamycin complex subunit wat1
Organism
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
314 amino acids
Function
component of both TORC1 and TORC2, which regulate multiple cellular processes to control cell growth in response to environmental signals. Nutrient limitation and environmental stress signals cause inactivation of TORC1. Active TORC1 positively controls cell growth and ribosome biogenesis by regulating ribosomal protein gene expression. TORC1 negatively controls G1 cell-cycle arrest, sexual development and amino acid uptake. Represses mating, meiosis and sporulation efficiency by interfering with the functions of the transcription factor ste11 and the meiosis-promoting RNA-binding protein mei2. TORC2 is required for cell survival under various stress conditions. TORC2 positively controls G1 cell-cycle arrest, sexual development and amino acid uptake. Positively regulates amino acid uptake through the control of expression of amino acid permeases (PubMed:17046992, PubMed:18076573, PubMed:17261596). May play a role in mRNA maturation as a coupling protein between splicing and synthesis and/or stabilization.
Similarity
Belongs to the WD repeat LST8 family.
Mass
35.133 kDa
Sequence
MSVQYPPQHSVLLVSSGYDHTIRFWEALSGICSRTIQHADSQVNRLCISPDKKFLAAAGNPHVRLYDINTSSQMPLMTFEGHTNNVTAIAFHCDGKWLATSSEDGTVKVWDMRAPSVQRNYDHKSPVNDLLIHPNQGELLSCDQSGRVRAWDLGENSCTHELIPEEDVPMSSITVGSDGSMLIAGNNKGNCYVWRMLNHQGASLLQPVVKFQAHQRYITRCVLSPDVKHLATCSADATVNIWSTEDMSFMLERRLQGHQRWVWDCAFSADSTYLVTASSDHVARLWELSSGETIRQYSGHHKAAVCVALNDYQI

Gene
pop3
Protein
Ribonucleases P/MRP protein subunit pop3
Organism
Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Length
201 amino acids
Function
Required for processing of 5.8S rRNA (short form) at site A3 and for 5'- and 3'-processing of pre-tRNA.
Similarity
Belongs to the POP3 family.
Mass
22.596 kDa
Sequence
MKKKQTKVKQTVKLVLRNPLSISWPIVDANTQEKLAQTLVQWLPASHKDILDSKLTVGLNSVNELLERCCQNAKDVTQPAVVFILHDQDSMLVTHMPQLVANANFYGSSKCRLVPLGFSAQALIAKKLGLSRAGAIAVQDDSPLWKYLKDLVMNIEEPQARWLSENPEYEVTKVEKIITSQKENQGTKKEGKNEKGNEFKK

Gene
POP3
Protein
Ribonucleases P/MRP protein subunit POP3
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Length
195 amino acids
Function
Required for processing of 5.8S rRNA (short form) at site A3 and for 5'- and 3'-processing of pre-tRNA.
Similarity
Belongs to the POP3 family.
Mass
22.612 kDa
Sequence
MSGSLKSLDKKIAKRRQVYKPVLDNPFTNEAHMWPRVHDQPLIWQLLQSSIINKLIHIQSKENYPWELYTDFNEIVQYLSGAHGNSDPVCLFVCNKDPDVPLVLLQQIPLLCYMAPMTVKLVQLPKSAMDTFKSVSKYGMLLLRCDDRVDKKFVSQIQKNVDLLQFPWLNAIKYRPTSVKLLKTTVPIVSKKRQK