About Services Plasmids Contact

ponK

Gene
ponK
Protein
Ponticulin-like protein K
Organism
Dictyostelium discoideum
Length
187 amino acids
Function
Binds F-actin and nucleates actin assembly.
Similarity
Belongs to the ponticulin family.
Mass
20.414 kDa
Sequence
MKNLILLFLLISIINLIQSLPLDSVINFYVNSTVGSCKGKQLEVSLDVCNNGCSNSFKITSSKDNVNNYNFTSYIETDDKQCLTNNYTINLFNCSIDNAALVGPYSVKCIFKETPSPSNSSNPSPSPNTTSSSSLSSSSLNSNEPNQTTKPPKTNEPQKNNSTSNIPNFFAIFGFLVLIIFILGDKI