About Services Plasmids Contact

ponC3

Gene
ponC3
Protein
Ponticulin-like protein C3
Organism
Dictyostelium discoideum
Length
147 amino acids
Similarity
Belongs to the ponticulin family.
Mass
15.29 kDa
Sequence
MKFTKSLLLLIVAVFASSNAAETFSNFQVTNSDANSPCVTTPVELKVNTCQSACGSILNVLPVTGSTSKFTFNQFGAQDTKCAATPTSSNEFTCVDGKSKVAIGSTTYSVVCVPDKTNSSESDSSDSTRIGASFALFALALLSMLAL