pimA

Phosphatidyl-myo-inositol mannosyltransferase

386 amino acids

Involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM). Catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1) (PubMed:12068013, PubMed:19638342, PubMed:19520856). In contrary to PimB, the mannosyltransferase PimA is unable to transfer a mannose residue to the position 6 of the phosphatidyl-myo-inositol of PIM1 (PubMed:19638342).

Belongs to the glycosyltransferase group 1 family. Glycosyltransferase 4 subfamily.

41.22 kDa

MRIGMVCPYSFDVPGGVQSHVLQLAEVLRDAGHEVSVLAPASPHVKLPDYVVSGGKAVPIPYNGSVARLRFGPATHRKVKKWIAEGDFDVLHIHEPNAPSLSMLALQAAEGPIVATFHTSTTKSLTLSVFQGILRPYHEKIIGRIAVSDLARRWQMEALGSDAVEIPNGVDVASFADAPLLDGYPREGRTVLFLGRYDEPRKGMAVLLAALPKLVARFPDVEILIVGRGDEDELREQAGDLAGHLRFLGQVDDATKASAMRSADVYCAPHLGGESFGIVLVEAMAAGTAVVASDLDAFRRVLADGDAGRLVPVDDADGMAAALIGILEDDQLRAGYVARASERVHRYDWSVVSAQIMRVYETVSGAGIKVQVSGAANRDETAGESV

pimA

Phosphatidyl-myo-inositol mannosyltransferase

381 amino acids

Involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM). Catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1).

Belongs to the glycosyltransferase group 1 family. Glycosyltransferase 4 subfamily.

40.987 kDa

MRVGLVCPYSFARPGGVQNHVLGLGGWLKEQGHDVSIIAPGQASRSLLAETGLVPSEFVSAGRAVPVTFNGSVARINFGVGPALKVKKWLDQGNFDVVHLHEPIAPTICLLALYLTDRPVTATFHTATPELTAIRFANRVLPRMVSRIDAAIAVSSEAADVAHHYSGVNPVVIGNGIHLADYPLVRATSRWRGGEHPLITFLGRYDEPRKGFEVLTAALPLVRATYPDLEVVVIGSGTARSVEGVRFLGGLDDEERNAWLGRSDIYIAPQTGRESFGIVLLEAMACGAPVVAANLRAFLDVLTDDEGLVGHTFRVGNSASASRAMLRSLSEPRDLRLERGRALAANYDWSVIGPQVVAMYTVAGQNYATSRGIKNRELKGH

pimA

Phosphatidyl-myo-inositol mannosyltransferase

378 amino acids

Involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM). Catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1).

Belongs to the glycosyltransferase group 1 family. Glycosyltransferase 4 subfamily.

40.445 kDa

MRIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDYFVSGGRAVPIPYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPSLSMLALNIAEGPIVATFHTSTTKSLTLTVFQGILRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVDSFASAARLDGYPRQGKTVLFLGRYDEPRKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGRLAAHLRFLGQVDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRRVLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRRYDWSVVASQIMRVYETVAGSGAKVQVAS

pimA

Phosphatidyl-myo-inositol mannosyltransferase

378 amino acids

Involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM). Catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1) (PubMed:15939292). PimA plays an essential role for growth in macrophages and during both the acute and chronic phases of infection (PubMed:25049093).

Belongs to the glycosyltransferase group 1 family. Glycosyltransferase 4 subfamily.

40.445 kDa

MRIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDYFVSGGRAVPIPYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPSLSMLALNIAEGPIVATFHTSTTKSLTLTVFQGILRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVDSFASAARLDGYPRQGKTVLFLGRYDEPRKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGRLAAHLRFLGQVDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRRVLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRRYDWSVVASQIMRVYETVAGSGAKVQVAS

pimA

Phosphatidyl-myo-inositol mannosyltransferase

378 amino acids

Involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM). Catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1).

Belongs to the glycosyltransferase group 1 family.

40.445 kDa

MRIGMICPYSFDVPGGVQSHVLQLAEVMRTRGHLVSVLAPASPHAALPDYFVSGGRAVPIPYNGSVARLRFGPATHRKVKKWLAHGDFDVLHLHEPNAPSLSMLALNIAEGPIVATFHTSTTKSLTLTVFQGILRPMHEKIVGRIAVSDLARRWQMEALGSDAVEIPNGVDVDSFASAARLDGYPRQGKTVLFLGRYDEPRKGMAVLLDALPKVVQRFPDVQLLIVGHGDADQLRGQAGRLAAHLRFLGQVDDAGKASAMRSADVYCAPNTGGESFGIVLVEAMAAGTAVVASDLDAFRRVLRDGEVGHLVPVDPPDLQAAALADGLIAVLENDVLRERYVAAGNAAVRRYDWSVVASQIMRVYETVAGSGAKVQVAS

pimA

Phosphatidyl-myo-inositol mannosyltransferase

374 amino acids

Involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM). Catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1).

Belongs to the glycosyltransferase group 1 family. Glycosyltransferase 4 subfamily.

40.273 kDa

MRIGMICPYSFDVPGGVQSHVLQLAEVMRARGQQVRVLAPASPDVSLPEYVVSAGRAIPIPYNGSVARLQFSPAVHSRVRRWLVDGDFDVLHLHEPNAPSLSMWALRVAEGPIVATFHTSTTKSLTLSVFQGVLRPWHEKIIGRIAVSDLARRWQMEALGSDAVEIPNGVNVDSLSSAPQLAGYPRLGKTVLFLGRYDEPRKGMSVLLDALPGVMECFDDVQLLIVGRGDEEQLRSQAGGLVEHIRFLGQVDDAGKAAAMRSADVYCAPNIGGESFGIVLVEAMAAGTPVVASDLDAFRRVLRDGEVGHLVPAGDSAALADALVALLRNDVLRERYVAAGAEAVRRYDWSVVASQIMRVYETVATSGSKVQVAS