phoU2

Phosphate-specific transport system accessory protein PhoU homolog 2

235 amino acids

Plays a role in the regulation of phosphate uptake.

Belongs to the PhoU family.

26.821 kDa

MNRLLNEKVEEFKKGVLKAGWFIEKMFRNSISSLVERNESLAREVIADEEVVDQMEVEIQEKAMEVLGLFSPIGKPLLTVTAGIRVAELIENIADKCHDIAKNVLELMEEPPLKPLEDIPAMANQTSEMLKFALRMFADVNVEKSFEVCRMDSKVDDLYEKVREELLLYMMESPKYVKRALLLLEIAGNIEIIADYATNIVEVSVYMVQGEAYKCYHDELLLFKKSGGVLFESSD

phoU2

Phosphate-specific transport system accessory protein PhoU homolog 2

213 amino acids

Plays a role in the regulation of phosphate uptake. In this role, it may bind, possibly as a chaperone, to PhoR, PhoP or a PhoR-PhoP complex to promote dephosphorylation of phospho-PhoP, or inhibit formation of the PhoR-PhoP transitory complex (By similarity).

Belongs to the PhoU family.

23.514 kDa

MRTAYHEQLSELSERLGEMCGLAGIAMERATQALLQADLVLAEQVISDHEKIATLSARAEESAFVLLALQAPVAGDLRAIVSAIQMVADIDRMGALALHVAKIARRRHPQHALPEEVNGYFAEMGRVAVELGNSAQEVVLSHDPEKAAQIREEDDAMDDLHRHLFTVLMDREWKHGVAAAVDVTLLSRFYERFADHAVEVARRVIFQATGAFP

phoU2

Phosphate-specific transport system accessory protein PhoU homolog 2

213 amino acids

Plays a role in the regulation of phosphate uptake. In this role, it may bind, possibly as a chaperone, to PhoR, PhoP or a PhoR-PhoP complex to promote dephosphorylation of phospho-PhoP, or inhibit formation of the PhoR-PhoP transitory complex (By similarity).

Belongs to the PhoU family.

23.514 kDa

MRTAYHEQLSELSERLGEMCGLAGIAMERATQALLQADLVLAEQVISDHEKIATLSARAEESAFVLLALQAPVAGDLRAIVSAIQMVADIDRMGALALHVAKIARRRHPQHALPEEVNGYFAEMGRVAVELGNSAQEVVLSHDPEKAAQIREEDDAMDDLHRHLFTVLMDREWKHGVAAAVDVTLLSRFYERFADHAVEVARRVIFQATGAFP

phoU2

Phosphate-specific transport system accessory protein PhoU homolog 2

213 amino acids

Plays a role in the regulation of phosphate uptake. In this role, it may bind, possibly as a chaperone, to PhoR, PhoP or a PhoR-PhoP complex to promote dephosphorylation of phospho-PhoP, or inhibit formation of the PhoR-PhoP transitory complex (By similarity). Important for tolerance to antibiotics.

Belongs to the PhoU family.

23.514 kDa

MRTAYHEQLSELSERLGEMCGLAGIAMERATQALLQADLVLAEQVISDHEKIATLSARAEESAFVLLALQAPVAGDLRAIVSAIQMVADIDRMGALALHVAKIARRRHPQHALPEEVNGYFAEMGRVAVELGNSAQEVVLSHDPEKAAQIREEDDAMDDLHRHLFTVLMDREWKHGVAAAVDVTLLSRFYERFADHAVEVARRVIFQATGAFP