pho88

SRP-independent targeting protein 3 homolog

194 amino acids

May function in a SRP (signal recognition particle) and GET (guided entry of tail-anchored proteins) independent pathway for targeting a broad range of substrate proteins to the endoplasmic reticulum. Involved in inorganic phosphate uptake. Also involved in telomere length regulation and maintenance (By similarity).

Belongs to the PHO88 family.

21.964 kDa

MVSRWEKLKNNPQTKSIGISIFLMMITRVIDFSRPSLLWPLRILYATVNIVQIGIFLYTKIIIEKKNDLTVLKYVEPATPMSGREHSKFVATTVRDYDLSKLLTSFKQMLVTIATTLFMHLYMGYAPPLLLQSVSAARGLFDNSEVQIHVQNKPAIDELRRPFKSSGGLLGSFGQVLTDKKSVDEAELTKLKPT

PHO88

SRP-independent targeting protein 3

188 amino acids

Functions in the SND pathway, a SRP (signal recognition particle) and GET (guided entry of tail-anchored proteins) independent pathway for targeting a broad range of substrate proteins to the endoplasmic reticulum. SND functions in parallel to GET in targeting proteins with downstream hydrophobic motifs (PubMed:27905431). Involved in inorganic phosphate uptake (PubMed:8709965). Also involved in telomere length regulation and maintenance (PubMed:16552446).

Belongs to the PHO88 family.

21.137 kDa

MNPQVSNIIIMLVMMQLSRRIDMEDPTIIMYIRILYCSSIGISWIIYQMARKRIVAKNDMTTMKYVEPGNAMSGEGEKLQVTTVRDYDLKEIDSAIKSIYTGMAMMGFMHLYLKYTNPLFMQSISPVKSALEHNEVKIHLFGKPATGDLKRPFKAPSLFGGMGQTGPKTDKKSIEEAERAGNAGVKAE