phiA

Cell wall protein phiA

186 amino acids

Cell wall protein involved in development of asexual structures such as phialide and conidium development, and thus required for spore formation (By similarity). Plays a role as a general stress protectant produced by the fungus in competition with antagonistic bacteria (By similarity).

Belongs to the phiA family.

19.809 kDa

MKLLAIISASLALAGFTTATPPPQTFSIKAKGNPKVPSARFDASRSNIFLNYGDSGAVCEVKPGCPKPKDAVFYLKDSILYLYTGSSNPVQKVFLDRSGFGQGKIGYLTGDGQLPSRWEVQGWTIDGAGNLKFKGKGLIACPTSDPKIKSWTVWADLGIATPGGNKGCLPFTAHTMKTKPVACKYT

phiA

Cell wall protein phiA

185 amino acids

Cell wall protein involved in development of asexual structures such as phialide and conidium development, and thus required for spore formation (By similarity). Plays a role as a general stress protectant produced by the fungus in competition with antagonistic bacteria (By similarity).

Belongs to the phiA family.

19.38 kDa

MQIKSFVLAASAAATASAAACQAPTNKYFGIVAIHSGSAVQYQPFSAAKSSIFAGLNSQNASCDRPDEKSATFYIQDGSLYLYAASATPQEIFVDRSGMGQGKIGYTTGAQPAPRNSERQGWAIDSQNHLQFQGKDLIACPNSIDGAWSIWADAGVANPAGNTDCVGIAARVEDVTNPNSCVYTQ

phiA

Cell wall protein phiA

185 amino acids

Cell wall protein involved in development of asexual structures such as phialide and conidium development, and thus required for spore formation (By similarity). Plays a role as a general stress protectant produced by the fungus in competition with antagonistic bacteria (By similarity).

Belongs to the phiA family.

19.38 kDa

MQIKSFVLAASAAATASAAACQAPTNKYFGIVAIHSGSAVQYQPFSAAKSSIFAGLNSQNASCDRPDEKSATFYIQDGSLYLYAASATPQEIFVDRSGMGQGKIGYTTGAQPAPRNSERQGWAIDSQNHLQFQGKDLIACPNSIDGAWSIWADAGVANPAGNTDCVGIAARVEDVTNPNSCVYTQ

phiA

Cell wall protein phiA

184 amino acids

Cell wall protein involved in development of asexual structures such as phialide and conidium development, and thus required for spore formation (By similarity). Plays a role as a general stress protectant produced by the fungus in competition with antagonistic bacteria (PubMed:24229396).

Belongs to the phiA family.

19.18 kDa

MQLKNLIFAAATAAALPATDAATNEPFGVISIHSGSGVQYAPINAALGSIFAGLKSQNASCSNPQDQTATFFLDDGALYLYDQSATPQELYVDRSGMGQGKIGYTTGAQPAPKNGERKGWSIDANNHLQFGGKDLIACPNSIEGAWSIWADAGVAKPGYNEGCEGIAARVEVSKNPNVCSYTSN

phiA

Cell wall protein phiA

182 amino acids

Cell wall protein involved in development of asexual structures such as phialide and conidium development, and thus required for spore formation (PubMed:14599891). Plays a role as a general stress protectant produced by the fungus in competition with antagonistic bacteria (By similarity).

Belongs to the phiA family.

18.77 kDa

MKLTSTAALASLAVAATAAPSTPETFGLVAIRSGDAVQYAGFNAALGSIFAGLPKQNATCEGTDSGFATFYIKDGALYLYGSEETQEIYVDRSGMGQGLIGYTTGDNASGPRNSERTGWSIDENNHLVFDGNSLIACPNSIDSAYSIWASAGVANPGGNKDCVGIAARVEKTENPIACTYSS