PCN

WD repeat-containing protein PCN

815 amino acids

Involved in auxin signaling pathway. Required for embryo development and meristem organization. Functions in the auxin pathway, integrating auxin signaling in the organization and maintenance of the shoot apical meristem (SAM) and root apical meristem (RAM).

90.27 kDa

MLEYRCSSVDWKPSPVVALANSSDDSQVAAAREDGSLEIWLVSPGAVGWHCQLTIHGDPNSRISSLAWCCSPSIGLPSGRLFSSSIDGSISEWDLFDLKQKIVLESIGISIWQMALAPISGFSSDVEGIKNGYLSEKSNDEEEIGSEEDGSDSDEFHEKSEEEIDRILAAACDDGCVRLYRISNLEKLTYYRSLPRVSGRALSVTWSPDAKRIFSGSSDGLIRCWDATSCHEVYRITAGLGGLGSSSEICVWSLLSLRCSVLVSGDSTGTVQFWDSEHGTLLEAHSNHKGDVNTLAAAPSHNRVFSAGADGQVILYKLSGSTNGSQDLKPSSSQKWDYIGYVKAHTHDIRALTVAVPISREDPFPDDILPDKASRKHRKKGKPVDFTYHKWAHLGVPMLISAGDDAKLFAYSIQEFTKFSPHDICPAPQRIPMQMVHNSMFNKTSLLLVQGISTLDILRLNISSDSSGRASTKSLVRVKSRDARKIICSAISNTGSHFAYSDQIGPSLFELKKNEFTKCPWSVSRRRLPELPFAHSMIFSSDCSRLIIAGHDRRIYTIDISSLELVYAFTPSREEHEGEAPTPKEPPITKLFTSSDGQWLAAINCFGDIYVFNLETQRQHWFISRLDGASVTAAGFHPWNNNALVISTSSNQVFAFDVEARQLGKWSLLNTYVLPKRYQEFPGEVLGLSFSPSPNSSSVIVYSSRAKCLIDFGKPVEEDEEYDLPNGNLSKTLEGKLVNLGLKKGKGTNRKRRLDEYQLEGKSNERKNFEILPSNHPVLFVGHLSKNSILVIEKPWMDVVKSLDNQPVDRHIFGT

pcn

DNA polymerase sliding clamp

253 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

28.625 kDa

MVEFRAYQEEARYFKYAFNAAGKVVEEAPLIVTENGIVSRAMDASHIAMAVLEMPWEMFDEYEPPSDELMYGLDMEEVTRIVRRARVTDEITLEGEDEEEVIIKLGSSGYEREFRLRSIDIDDIPDEPELDFAVEVTVVPDFIQDAVRDADLVSDTVKVGAKGNTFYFKAEGERGRVIPKVQEGAEALLTFEVEEDVETAYPLDYLKDMIQAAQGAESVRIRLGQDMPLELTFRIGPAGEGKLTFYLAPRVEE

pcn

DNA polymerase sliding clamp

250 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.824 kDa

MFRATCNTRDFKKVINATSNLVDEICFEVDENGIKASAMDPSHVALVSMEMPKDVFEEYEGDVHDIGIDLEALKKIIARGKGDEKLILDLDAEKNKLNVTFKSNVTRKFSIALYDVSSSNLKVPDIEYPNNVSIKAGAFVEALKDAELVNDHITLKVDEDKFIIYSKGDLNQSETVFDNGVDDDDDTLAEFNMGEASRSTFNLAYLKDLTKSTAAEDLLKIYLGSDMPVKIEYEVSGSKLVFLLAPRIES

pcn

DNA polymerase sliding clamp

250 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.865 kDa

MFRATCNTRDFKKVINATSNLVDEICFEVDENGIKASAMDPSHVALVSMEMPKEVFEEYEGDIHDIGIDLEALKKIIARGKGDEKLILDLDVEKNKLNVTFKSNVTRKFSIALYDVSSSNLKVPDIEYPNNVSIKAGAFVEALKDAELVNDHITLKVDEDKFIIYSKGDLNQSETVFDNGIEDDDATLAEFNMGEASRSTFNLAYLKDLTKSTAAEDLLKIYLGSDMPVKIEYEVSGSKLVFLLAPRIES

pcn

DNA polymerase sliding clamp

250 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.902 kDa

MFRATCNTRDFKKVINATSNLVDEICFEVDENGIKASAMDPSHVALVSMEMPKDVFEEYEGDIQDIGIDLEALKKIIARGRGDEKLILDLDTEKNKLNVTFKSNVTRKFSIALYDVSSSNLKVPDIEYPNSVSIKAGAFVEALKDAELVNDHITLKIDEDKFIIYSKGDLNQSETVFDNSIEDDDNALAEFNMGEASRSTFNLAYLKDLTKSTAAEDLLKIYLGSDMPVKIEYEVSGSKLVFLLAPRIES

pcn

DNA polymerase sliding clamp

250 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.871 kDa

MFRATCNTRDFKKVINATSNLVDEICFEVDENGIKASAMDPSHVALVSMEMPKDVFEEYEGDIQDIGIDLEALKKIIARGRGDEKLILDLDVEKNKLNITFKSNVTRKFSIALYDVSSSNLKVPDIEYPNSVSIKAGAFVEALKDAELVNDHITLKIDENKFVIYSKGDLNQSETVFDNSIDDDDNALADFNMGEASRSTFNLAYLKDLTKSTAAEDLLKIYLGSDMPVKIEYEVSGSKLVFLLAPRIES

pcn

DNA polymerase sliding clamp

249 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

28.115 kDa

MRVTFPDAKALKKIVPIVADLISEGQFVATEEGIKLVAMDPASIAMVIWEMKPEAFIDYTIEGDKEIITVSMDDLKTIVKKLKQREMVVWETDREKNKLKILARGTIKKTFSIPLLEGEETETPIPSLEYNNVVELDSKAIKEIIDDASAIADSLKFKAEPPSKLIIKAEGEMKEMTVELTEGEDAVVSIDIQEEAYASYSIDYLKKFAKAADVSDIAILKLKTDYPLWLEYRYLDKMTLIFILAPRSD

pcn

DNA polymerase sliding clamp

249 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication (By similarity). Regulates activity of NucS endonuclease and prevents non-specific cleavage.

Belongs to the PCNA family.

28.035 kDa

MPFEIVFEGAKEFAQLIETASRLIDEAAFKVTEEGISMRAMDPSRVVLIDLNLPASIFSKYEVDGEETIGVNMDHLKKVLKRGKAKETLILRKGEENFLEISLQGTATRTFKLPLIDVEEIEVDLPELPFTAKVVILGDVIKEAVKDASLVSDSMKFIAKENEFTMRAEGETQEVEVKLTLEDEGLLDIEVQEETKSAYGISYLSDMVKGLGKADEVTIKFGNEMPMQMEYYIRDEGRLIFLLAPRVEE

pcn

DNA polymerase sliding clamp

249 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase to DNA during high-speed replication. Unlike its eukaryotic paralog, loads on circular DNA without the replication factor C (RFC) clamp loader, although RFC greatly increases loading efficiency. Stimulates the ATPase activity of replication factor C (RFC) in the presence of ssDNA. Stimulates the helicase activity of Hel308 and may alter its substrate specificity.

Belongs to the PCNA family.

28.005 kDa

MPFEIVFEGAKEFAQLIDTASKLIDEAAFKVTEDGISMRAMDPSRVVLIDLNLPSSIFSKYEVVEPETIGVNMDHLKKILKRGKAKDTLILKKGEENFLEITIQGTATRTFRVPLIDVEEMEVDLPELPFTAKVVVLGEVLKDAVKDASLVSDSIKFIARENEFIMKAEGETQEVEIKLTLEDEGLLDIEVQEETKSAYGVSYLSDMVKGLGKADEVTIKFGNEMPMQMEYYIRDEGRLTFLLAPRVEE

pcn

DNA polymerase sliding clamp

249 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

28.097 kDa

MPFEIVFEGAKEFAQLIETASRLIDEAAFKVTEEGISMRAMDPSRVVLIDLNLPSSIFSKYEVDGEETIGVNMDHLKKVLKRGKAKDTLILRKGEENFLEISLQGTATRTFRLPLIDVEEIEVELPDLPYTAKVVVLGEVLKEAVKDASLVSDSIKFMAKENEFIMRAEGETQEVEVKLTLEDEGLLDIEVQEETKSAYGVSYLADMVKGIGKADEVTMRFGNEMPMQMEYYIRDEGRLTFLLAPRVEE

pcn

DNA polymerase sliding clamp

249 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

28.043 kDa

MPFEIVFDGAKEFADLIATASNLIDEAAFKVTDEGISMRAMDPSRVVLIDLNLPESIFSKYEVEEEETIGINMDHFKKILKRGKGKDTLILKKGDENFLEITFEGTAKRTFRLPLIDVEELELDLPELPFTAKVVLLGEVLKEAVKDASLVSDAMKFIAKENEFSMRAEGETNEVEIKLTLEDEGLLDIEVEEETKSAYGISYLADMVKGIGKADEVTIRFGNEMPLQMDYFIRDEGKLTFLLAPRVED

pcn

DNA polymerase sliding clamp

249 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

28.125 kDa

MPFEIVFDGAKEFADLIATASNLIDEAAFKITEEGVSMRAMDPSRVVLIDLNLPESIFSKYEVEEPETIGINMDHFKKILKRGKSKDTLILRKGDENFLEITFEGTAKRTFRLPLIDVEELELELPELPFTAKVVLLGEVLKEAIKDASLVSDSLKFIAKEDEFTMKAEGETNEVEIKLTLEDEGLLDLEVEEETRSAYGISYLADMVKGIGKADEVTLRFGTEMPLQMDYFIRDEGKLTFLLAPRVEE

pcn

DNA polymerase sliding clamp

249 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

28.138 kDa

MPFEIVFDGAKDFADLIATASNLIDEAAFKITEEGISMRAMDPSRVVLIDLNLPESIFSKYEVEEEETVGINMDHFKKILKRGKNKDTLILRKGDENFLEITFEGTAKRTFRLPLIEVEELELDLPELPFTAKVVVLGEVLKEAVKDASLVSDALKFIARENEFIMKAEGETNEVEIKLTLEDEGLLDLEVEEETKSAYGISYLADMIKGIGKADEVIIRFGNEMPLQMEYPIRDEGKLIFLLAPRVED

pcn

DNA polymerase sliding clamp

249 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.908 kDa

MPFEIVFDGAKEFADLIDTASNLIDEAAFKIAEEGMSMRAMDPSRVVLLDLNLPASIFSKYDIDGEETVGVNMDHFKKVLKRGKGKDILVLRKGEENFLEITLEGTAKRTFRLPLIEVEELELDLPELPFTVRAVILGEVLKEAVKDASLVSDSIKFIAKENEFIMKAEGETQEVEIKLTLEDEGLLDLNVEEETKSAYGVSYLADMAKGIGKADEVVLRFGNEMPLQMDYPIRDEGRLTFLLAPRVEE

pcn

DNA polymerase sliding clamp

249 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.865 kDa

MFKATCNSRDFKKVINATSNLVDEICFEVDETGIKASAMDPSHVALVSMGMPKEVFESYEGDIHDIGIDLEALKKIIARSKGDEKLILELDDEKNKLNVTFKSNVTRKFSIALYDVSSSNLKVPDISYPNQVSIKAGAFVEALKDAELVNDHITLKVDEDKFVIYSKGDLNQSETVFENNNDEYETLTEFKMSEPSKSTFNLAYLKDLTKSTSAEDILKIYLGSDMPVKIEYEVSGSKLVFLLAPRIES

pcn

DNA polymerase sliding clamp

248 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.175 kDa

MTFGAKTSGSDDLKAIISAISTLVEEATFVATAEGISFRGMDPSHVALIDISWPNSAFEKYECDSDIKFGVRIDEFSKLIKRADKKDSIEISISEQNMLLVTVGKNKKYKMRLIESSATDTPLPKIPYDSKIILSSSKFDKILGDVQVVSDYLTIHTSDSKGDFSGKGDSGEVVIDLDKDDEGIEEISSKEDSVGTYSLEYLNPVVKAVGTTAGFITCEFSSAKPLRIEFKVANIGRIHFYLAPRVES

pcn

DNA polymerase sliding clamp

248 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.925 kDa

MAFSAKTSGSDDLKAIISAISTLVEEATFVATAEGITFRGMDPSHVALIDISWPNSAFEKYECDSNIKFGVRIDEFTKLIKRADKKDSITISVSKDSMLLIDIGSNKKYKIRLIESSATDTPLPKISYDAKIELATTSFEKILGDVQVVSDYLTIKAKPTGVEFAGKGDSGEAAIDVKKDDDSMEALKVKKESEGTYSLEYLNPIVRAVGGAAGSVTCEFSDAKPLRVEFKVANIGRIHFYLAPRVSS

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.955 kDa

MFKAIVSADTLGAALDSVSVLVDECKVRLDEEGLTIRAVDPANVGMVDLELSASAFESYETDGGVIGVNLDRLEDIVGMADSGQLVHLDLDEETRKLHISLDGLEYTLALIDPDSIRQEPDLPDLDLSSEIVIEGADIDRAVTAADMVSDHIALGVDPDAEEFYVDAEGDTDDVHLELDREDLIDLTPGEARSLFSLDYLKDMNKAIPKDAEVTMELGEEFPVKMHFDFAEGDGHVTYMLAPRIQSD

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.583 kDa

MVKFVFPDAREWKYIIESLATIVDEANFVASPEGLKLRALDPGRIAMVDLFIPSNLFEEYSVDQETKISAVLDDIDKVLKRAKSDDKISFEVSQGRLIITLSGRAERRFKFPLIDIAGQELPSPKLNFTVAAKMLSDTFRDALKDASLVSESVKLKAEDESLWLLARSDKGEIESRFSIETGSLVEIDVKEAAEASYGIDFLDKIVSKAYRISDILGLRFATNMPLEMTFDIAGGGTLKYLLAPRME

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.202 kDa

MLKATISADIFKDTVDALSALVTECRLHFSETEVWARAVDTANVAMIILTLKKEAFSQFEATTGEIGLDIAKLKNTYSMMGKASDIRLEHQEGANKIEVTFEGYHYSITLLDSNTIKKDPNAPGIQLPGQVTISGSELYNVIKSASIVSDKIWFAIEPEKKEFVLYAEGDSDNIRRAFSAGEVIASNWEPAKSLFSIDYLKDMGKVMSHAEKVTIDLGVDHPVKFSFEIAGGNGQVEYLLAPRIEAD

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.638 kDa

MFRGVMESAKEFKKVVDTISTLLDEICFEVDEEGIKASAMDPSHVALVSLEIPRLAFEEYEADSHDIGIDLEAFKKVMNRAKAKDRLILELDEEKNKLNVIFENTGKRKFSLALLDISASSVKVPEIEYPNVIMIKGDAFKEALKDADLFSDYVILKADEDKFVIHAKGDLNENEAIFEKDSSAIISLEVKEEAKSAFNLDYLMDMVKGVSSGDIIKIYLGNDMPLKLEYSIAGVNLTFLLAPRIEG

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.908 kDa

MLKATIEADIFRETIDAVSALVNECRLHVDEKGIRTITVDTSNVAMVSLELSASAFLTFAAEPCEIGLDIEKIRSMMSMIGKTDIVSLELDESGKKLKISFGGYEYSITLLDTKTIRKDPNAPNLNLPATFEVPGVMFNDAIKASSMVSDKISLAVSAETCVFTMNADGDSDRIKRELTGDDVHYLTCADARSLFSLDYLKDMGKSIGRAEKVQIRLGTDHPVQFSFVYAGGKGSVGYLLAPRIEAD

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.79 kDa

MLKATIDAEIFRESIDAIAALVTECRLHTAEDQIRTRSVDTANVAMVSLELQSTAFNSFSATAGELGLDIAKMKNIIGMMGKGDALTLTLLDEERKLELSFGGYRYSISLLDVNTIRKDPNPPGIDLPGKAVVPGDALNNAIKAAAVISDKIALGIDPDAMTFYMEAEGDTDHIKLALGEDELVALSPVQARSLFSIDYLKDMGRVMARADKVEVYLGIDHPVRFVFDIADGNGRVEYLLAPRIEAD

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.92 kDa

MLDATIDADVFRESVDAIAALVTECRLHATEQGLRTRTVDTANVAMISLELDKDVFESYQATSSEMGIDIVKIKNVLSMMGKGDPVHLALAEESRKLEVSFQSYQYSITLLDTNTIRKDPNAPTIELPGKVVISGAALSAAIKAASVVSDKIALGIDPEKGIFYMEAEGDTDHIRLELGDDKLISLVPVQARSLFSLDYLKDMGKTMSKAEKVEISLGIDHPVEFTFDIADGKGHVMYLLAPRIEAD

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.841 kDa

MFKAIVGASTLQDALDSVSVLVDECKIRLNDEELSIRAVDPANVGMVDLTLEAAAFESYEADGGVIGVNLARLEDIAGMANSGDLIHLELNEETRKLHIEIDGLSYTLALIDPDSIRQEPDIPDLDLASEIVVEGAQINRGITAADMVSDHIRLRVDETDEAFFIEAEGDTDDVDLRLAREDLIALTAGPADSLFSLDYLKDMNKAIPSDAEVTIELGEEFPVKLHYGFAEGLGHVTFMLAPRIQSD

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.06 kDa

MFNAIVSADTLQATLDSVSVLVDECKIHLEEDGLEIRAVDPANVGMVDLRLDAAAFESYETDGGLIGVNLSRLEDIAGMADAGQLVHLDLDEETRKLHISIDGLEYTLALIDPDSIRQEPDLPDLDLSANIVIEGKDIDRSVTAADMVSDHIALGVDATDELFYVDAEGDTDDVHLELTRDDLIDLTPGDAHSLFSLDYLKNMNKAIPKDAEVEMELGEEFPVKMHFSFAEGQGRVTYMLAPRIQSE

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.824 kDa

MFKAIVSADTLQETLDSVSVLVDECKIHLDDDTLSIRAVDPASVGMVDLDLAATAFESYEADGGLIGVNLSRLEDIAGMADAGQLIQLELDEETRKLHIQIDGLEYTLALIDPDSIRQEPDIPDLDLPAHVAIEGRDIDRAVTAADMVSDHIALGVDTGDDLFYVNAEGDTDDVHLELAPDQLIDLDAGDAHSLFSLDYLKDMNKAIPTTAEVELELGDEFPIKLHFDIADAQGHVTYMLAPRIQSN

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.824 kDa

MFKAIVSADTLQETLDSVSVLVDECKIHLDDDTLSIRAVDPASVGMVDLDLAATAFESYEADGGLIGVNLSRLEDIAGMADAGQLIQLELDEETRKLHIQIDGLEYTLALIDPDSIRQEPDIPDLDLPAHVAIEGRDIDRAVTAADMVSDHIALGVDTGDDLFYVNAEGDTDDVHLELAPDQLIDLDAGDAHSLFSLDYLKDMNKAIPTTAEVELELGDEFPIKLHFDIADAQGHVTYMLAPRIQSN

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.827 kDa

MFKAIVGASTLQDALDSVSVLVDECKIRLNEGELAIRAVDPANVGMVDLALDTAAFESYTADDGVIGVNLSKLEDFIGMASGDQLVELELDEETRKLNIQMDGLSSTLALIDPDSIRQEPDIPDLDLAAEIMLEGAQLDRGIKAADMVSDHVRLRVASDTEAYHIEAEGDTDDVDFRLDTDDLIALTAGEADSLFSLDYLKDMNKAIPKDAEVTIELGQEFPVKVHYGIAEGYGEITYMLAPRIQSD

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.743 kDa

MFKAVMNAKNFKKIIDSISNLVDEICFEVDELGIKANAMDPSHVALISVNIPKESFDEYVSDTHDIGVDLEALKKIMNRAKPNEKLMLELDMEKNKLDIILKNEGTRKFSISLYDVSSSNVKVPEIGYPNEVMIKAGTIVESLKDAELVNDHVSLKITEDGKFIIYSKGDINTNETVLDRDNESIIELKISESSKSTYNLAYLKDITKATSSEDILHIHLGTDMPVKIEYIIGDTKLIYLLAPRIES

pcn

DNA polymerase sliding clamp

247 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.951 kDa

MLKATIDAEIFREAIEAISALVPECRLHTAEDGITTRAVDTANVAMIAFTLKKEAFDTFKATKSEIGVDISKMKNIFNMGGKGDLISLELADNAQKMAVSVHGYHYSITLLDTNTIRKDPNSPTINLPGKVVISGEDLNNAIKAAAVISDKIAMGINPKDQTFYMVAEGDTDHIQREFGKDELKSLSPVEARSLFSLDYLRDMGKVMSKATEVEVCLGIDHPVRFSFDIAGGNGHVEYLLAPRIEAD

pcn

DNA polymerase sliding clamp

246 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.582 kDa

MIRLNLSVKNLKEITDLLSTIVSEAKFRVDENGMSVTAVDPAHVAMIRLEVPKEAFVEFHTDGQEEIALDIDRLKSVIRLASSSENVGITKDGEKLKFELGTINKSISLLDPSTIVTPKIPNITSEYYAVLKKSDFERGLRAAEDISDSIRFTLSQDGFKAYSHSESEESEMILPKDLITDMSCNTTIKSSYPLEYLLKFIKAISSTDSLKLSFRDDYPLSVEFYLDQNPGAKIKGLFLLAPRMEQ

pcn

DNA polymerase sliding clamp

246 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.558 kDa

MIRMNISVRNLKEITDLLSTIVSEAKFKVDENGMSVTAVDPAHVAMIRLEVPKEVFSEFRSDGTEEIALDIDRLKSVIRLANSSENVGITKDKEKLKFDLGNISKSVSLLDPSTIVTPKIPNIASEYYAIIKRSDFERGLRAAEDISDSIRFVLSSEGFRATSHSESEESEMVLPKDMLSDLSCSDTIKSSYPLEYLLKFIKAVSSADSLKISFRDDYPLSIEFYLDQNPSAKIKGLFLLAPRMEQ

pcn

DNA polymerase sliding clamp

246 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.901 kDa

MFKAAINAEVFKDAIEAVSTLVDEAKFRITKDSISARAVDPANVAMVAFDLNAKAFDTFEATDGEIGIDLVRFMDILGMTARDDRLELNLNEETRKLEIRTGGLAYTLSLLDPGSIRKEPKVPALELPGKIVLNGAELKRAVKAAEKVSDHMALGVQDKTFYVEAEGDLDKVRLEIPESNLISLQATSNVRSLFSLDYLNDIVKSLGKAEQVTIDLGTDYPVKFTFSIASGNGTVIYLLAPRIESE

pcn

DNA polymerase sliding clamp

245 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.267 kDa

MIDVIMTGELLKTVTRAIVALVSEARIHFLEKGLHSRAVDPANVAMVIVDIPKDSFEVYNIDEEKTIGVDMDRIFDISKSISTKDLVELIVEDESTLKVKFGSVEYKVALIDPSAIRKEPRIPELELPAKIVMDAGEFKKAIAAADKISDQVIFRSDKEGFRIEAKGDVDSIVFHMTETELIEFNGGEARSMFSVDYLKEFCKVAGSGDLLTIHLGTNYPVRLVFELVGGRAKVEYILAPRIESE

pcn

DNA polymerase sliding clamp

245 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.086 kDa

MTRMSISVKNLKEIVDMLGTIVSEVKFKLEPNGISVTAVDPAHVAMISLDIPKNAFSEYDLDAPDEIAVDLDKVKSVIRLASSNDTIVISKDRDKLRFEIGTIIKSIALLDNNSVTTPRVPQINSDDYVILSKSDLEKGLRAAEDVSDAIRLTLTPESFSAKSTSDSDESEMLLPKDMLKDISCSQPIKSSYPLEYLLKLVKSISSNEDIKISFKSDYPLSIEFSFNSETEPISGKFLLAPRMES

pcn

DNA polymerase sliding clamp

245 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.759 kDa

MFKAAINAELLKDAVAALAVIVDEVRFKINPEGISVKAVDPANVAMGIFELGSSAFDEYNADECEIGVDLNKITDLLGIADKNDTVRMELEEENHKLLIDVGGLSYTLSLLDPSTIRAEPRVPQLELPAKVVLNGADLRRAVKAAEKISDHMLMGVSDDTFYMEAKGDTDQVRLEMGRDQLIDLKAGEACSLFSLDYLTDIVKPTNKVNEVTLSLGKDFPILIDFEIANGSGRISYLLAPRIESD

pcn

DNA polymerase sliding clamp

245 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.121 kDa

MFKATIDAYLLKDSIETLSVLVDEARFRISPEGVVVRAVDPANVAMVSFDLTPEAFDDFEANDCELGLDLSRINDILGVADRDDKVQMELDEESKKLKIQIGGFSYTISLLDPSTIRAEPRIPQLELPAEIVLNGKDLQKAVKAAEKISDHMLLGVEGESFFMEAEGDTDRVKLTMTRDQLIDIKPSQVRSLFSLDYLSDIIKPASKSNEISLHLGNDFPIKINFSIANGKGTIGYLLAPRIESD

pcn

DNA polymerase sliding clamp

245 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.65 kDa

MFKAAINAELLKDAIASLAVIVDEVRFKIKPEGISVKAVDPANVAMGIFELGSSAFEEYSADECEIGIDLNKITDLLGIADRNDTVRMELDEGSNKLLIDVGGLSYTLSLLDPSTIRAEPRVPQLELPAKVVLNGADLRRAVKAAEKISDHMLMGVSGDTFYMEAKGDTDQVRLEMGRDQLIDLKAGEACSLFSLDYLTDIVKPTNKVNEVTLSLGRDFPILIDFEIANGAGRISYLLAPRIESD

pcn

DNA polymerase sliding clamp

245 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

26.562 kDa

MFKAAINAELLKDAIAALAVIVDEVRFKIKPEGISVKAVDPANVAMGIFELGSSAFDEYSADECEIGLDLNKITDLLGIADRNDTVRMGLEEGSNKLLIDVGGLSYTLSLLDPSTIRAEPRVPQLELPAKVVLNGADLRRAVKAAEKISDHMLMGVSGDTFYMEAKGDTDQVRLEMGRDQLIDLKAGEACSLFSLDYLTDIVKPTNKVNEVTLSLGRDFPILIDFEIANGAGRISYLLAPRIESD

pcn

DNA polymerase sliding clamp

244 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.473 kDa

MFKAELSDSSILKTSFDAISSIVDEVQIQTDSEGMRLDALDRSHITFVHLELKASLFDEYVCDVPEKINIDTGEFMSVLKRAKSQDRVIMSLDEGNFIITFEGDATRTFKIRLIDIEYDNPTPPELEHPASFKVHFGILKDAINDIDIFSDKIALQVDEDYFRASADGEFGDASVKYLHGENINTQEKSLFSLDKIREMLKADKFSEEAEIGLGTDMPLKLTLNMVTGDGKLSFLLAPRLESDE

pcn

DNA polymerase sliding clamp

244 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.754 kDa

MFKLVLSDPSIFKTSFDAISSIVDEVQIEVDSDGLRLNAIDRSHITYVHLELKESLFDIYECDKPIKLNLDTEELMKVLKRSKNDDVMELTVDVGNLILTFEGAVKKTFKVKLIDLEYDTPSQPDIPYDIKIPIPVSILKEAIQDIEIVSDRVSFEVDEDKLTLEAVGDFADAKIEYLHGEKINEKARAVYAISNIKEMLKAEKFSDNTYLSIGTDMPLTLYLELLNEEGLLSFLLAPRLEEED

pcn

DNA polymerase sliding clamp

244 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase to DNA during high-speed replication (By similarity). In conjunction with replication factor C (RFC) stimulates DNA synthesis by PolB, relieving inhibition by replication protein A (RPA).

Belongs to the PCNA family.

27.969 kDa

MFKAELNDPNILRTSFDAISSIVDEVQIQLSAEGLRLDALDRSHITYVHLELKAELFDEYVCDEPERINVDTEELMKVLKRAKANDRVILSTDEGNLIIQFEGEAVRTFKIRLIDIEYETPSPPEIEYENEFEVPFQLLKDSIADIDIFSDKITFRVDEDRFIASAEGEFGDAQIEYLHGERIDKPARSIYSLDKIKEMLKADKFSETAIINLGDDMPLKLTLKMASKEGELSFLLAPRIEAEE

pcn

DNA polymerase sliding clamp

244 amino acids

Sliding clamp subunit that acts as a moving platform for DNA processing. Responsible for tethering the catalytic subunit of DNA polymerase and other proteins to DNA during high-speed replication.

Belongs to the PCNA family.

27.029 kDa

MLKAVIDAETLRDAIEAVSSLVDEVKFTITEKGLELKAVDPANVAMVSLKIDASAFEFYQATPGEIGVDLVRLSDLLSMADRGERVRLELLEDERKLRIGVGSLSYTLSLIDPSAIRKEPRIPELDLPAHVAIPGAEFRRAIKAAEKVSDHVVLGVKDDIFYMEAKGDIDALKLTMRSSELLDMKPGEARSLFSLDYLSDMSKSIGKAPEVKLEIGIDYPLRISFMLKDNVHVSYLLAPRIEQE