pchR

Regulatory protein PchR

296 amino acids

Positive activator of the genes for pyochelin and ferripyochelin receptors.

32.339 kDa

MTITIIAPPQADAAAPAPGNRPGVAHIDPNMKLVTGTFCSASEDWFEEPLERGLRLILVQSGQLRCRIPGQPEHLIEGPSLCTIANDGDFTSAQIYGTDKPLRYTIVQLGVEALDSRLGWLPEQLIRRPGGDPRIMSCPAPRAMQALASQIATCQMLGPTRDLYLGGKALELAALSAQFLSGEGRPVEEPRITCSEVERIHAARDLLVGALQEPPSLDTLASRVGMNPRKLTAGFRKVFGASVFGYLQEYRLREAHRMLCDEEANVSTVAYRVGYSPAHFSIAFRKRYGISPSEIR

pchR

HTH-type transcriptional regulator PchR

169 amino acids

Represses the expression of the yvmC-cypX operon, which is involved in pulcherriminic acid biosynthesis. Also negatively regulates yvmA, yvnB and its own expression. Positively regulates yisI expression. Acts by binding specifically to a 14-bp palindromic motif, the YvmB box, which is present in the promoter region of the target genes.

19.682 kDa

MSDLTKQMIYDIYVRLLHLNEQKANTSLQQFFKEAAEEDVAEIPKNMTSIHVIDCIGQHEPINNAGIARKMNLSKANVTKISTKLIKEEFINSYQLTDNKKEVYFKLTRKGRRIFDLHEKLHKKKELAFYQFLDSFSQEEQKAVLKFLEQLTSTLEAEQTDGTPDKPVK