Protein
Persistence and stress-resistance toxin PasT
Organism
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Function
Toxic component of a type II toxin-antitoxin (TA) system. Binds to 50S ribosomal subunits, preventing them from associating with 30S subunits to form 70S ribosomes (By similarity). In this strain of E.coli low levels of PasT complement operon disruption, however high levels are toxic; their effects are abrogated by high level expression of cognate antitoxin PasI. Plays a role in persistence after antibiotic exposure and survival of nitrosative stress; the toxic and persistence phenotypes are conferred by the same N-terminal region of the protein, while the stress resistance effects can be uncoupled from them in deletion mutants.
Similarity
Belongs to the ribosome association toxin RatA family.
Sequence
MILFVGFLLMEIVMPQISRTALVPYSAEQMYQLVNDVQSYPQFLPGCTGSRILESTPGQMTAAVDVSKAGISKTFTTRNQLTSNQSILMSLVDGPFKKLIGGWKFTPLSQDACRIEFHLDFEFTNKLIELAFGRVFKELAANMVQAFTVRAKEVYSAR