About Services Proteins Contact

pasI

Gene
pasI
Protein
Persistence and stress-resistance antitoxin PasI
Organism
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Length
96 amino acids
Function
Antitoxin component of a type II toxin-antitoxin (TA) system. Unlike the case in E.coli K12 high level expression of this protein abrogates the toxic effects due to overexpression of the cognate toxin PasT.
Similarity
Belongs to the UPF0125 (RnfH) family.
Mass
10.815 kDa
Sequence
MPGKIAVEVAYALPEKQYLQRVTLQEGATVEEAIRASGLLELRTDIDLTKNKVGIYSRPAKLSDIVHDGDRVEIYRPLIADPKELRRQRAEKSANK