pan

Protein pangolin, isoform J

1192 amino acids

Segment polarity protein. Functions together with arm to transduce the Wingless (Wg) signal in embryos and in developing adult tissues. Acts as a transcriptional activator, but in the absence of arm, it binds to gro and acts as a transcriptional repressor of wg-responsive genes.

Belongs to the TCF/LEF family.

132.08 kDa

MPHCGTTNSEINLNSNELISYQKKKSNEDLQKKHDKKCSINLKTSQVPDGGFNNQYTQLTANKIEQYNCNDLDKVCIVPSSRSDGMEASFSELLLSPNKLISQPWQTAEEIENWQNDSFRQRNEMFSCIYTNSMLNQQPCSQQQLLATQLLYARLLRSQLAEREFHSNKFNMVHYSGSKKTMLREDELLSTPSSQDNNNNIKLIKDIENSISCVDPPLFEFSNVHQRAEQKNKQDDKNCYSPKLKSNKEALDGYDLQHTCDFIREQKNILIDIKKKLDNLSDSSGKFRKRLSVRQSHIEVNNGSNSALEESVRRQLNGNRKSIENLLEEVKRLYNQWSSAELYYVRSLQRLGLPSEEDGEYTSTPTHTIMALAAIALSNESILPQKTNAVHSKIPDVESESDFFLTSAKPKTLVEIEDIILQLASSVNMHQSSSASTPHESYSDSVKSDCEESNSAPTCIWHSTRQTFRHKKDVEPCSTAAEIILEYASLSSSSNIETSRLLTSASNLTDVTENYNVTTQLPIVFNYNRESSAESIVTDPLLVPEFSTAPSTPSTGSNSGCSTGMVSGIFGLSQNRRKQRLARHIETLTTNSFKSNAIRGNVDNEITNQLKTSPSIRALPTENVSHLITKTLSSANASLTAQELSITNLFKERLCALQGNAGSMKTEIFPMIDAPYDLSIGSKTKHMNLEAKHTSNAQSNESKETTNDKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHELSREEQSKYYEKARQERQLHMELYPGWSARDNYGYVSKKKKRKKDRSTTDSGGNNMKKCRARFGLDQQSQWCKPCRRKKKCIRYMEALNGNGPAEDGSCFDEHGSQLSDDDEDDYDDDKLGGSCGSADETNKIEDEDSESLNQSMPSPGCLSGLSSLQSPSTTMSLASPLNMNANSATNVIFPASSNALLIVGADQPTAQQRPTLVSTSGSSSGSTSSISTTPNTSSTVSPVTCMTGPCLGSSQERAMMLGNRFSHLGMGLSPPVVSTSTSKSEPFFKPHPTVCNNPIFALPSIGNCSLNISSMPNTSRNPIGANPRDINNPLSINQLTKRREYKNVELIEASESKTIVAHAATSIIQHVAVNGYHANHSLLNSNLGHLHHQLNNRTENPNRSEQTMLSVSNHSVNSSECHKESDSQAIVSSNPPNAGSSDNGVISVS

pan

Protein pangolin, isoforms A/H/I/S

751 amino acids

Segment polarity protein. Functions together with arm to transduce the Wingless (Wg) signal in embryos and in developing adult tissues. Acts as a transcriptional activator, but in the absence of arm, it binds to gro and acts as a transcriptional repressor of wg-responsive genes.

Belongs to the TCF/LEF family.

81.892 kDa

MPHTHSRHGSSGDDLCSTDEVKIFKDEGDREDEKISSENLLVEEKSSLIDLTESEEKGHKISRPDHSPVFNKLDTHAPSFNMGYLVSPYSYANGSPSGLPVTMANKIGLPPFFCHNADPLSTPPPAHCGIPPYQLDPKMGLTRPALYPFAGGQYPYPMLSSDMSQVASWHTPSVYSASSFRTPYPSSLPINTTLASDFPFRFSPSLLPSVHATSHHVINAHSAIVGVSSKQECGVQDPTTNNRYPRNLEAKHTSNAQSNESKETTNDKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQILGRRWHELSREEQSKYYEKARQERQLHMELYPGWSARDNYGYVSKKKKRKKDRSTTDSGGNNMKKCRARFGLDQQSQWCKPCRRKKKCIRYMEALNGNGPAEDGSCFDEHGSQLSDDDEDDYDDDKLGGSCGSADETNKIEDEDSESLNQSMPSPGCLSGLSSLQSPSTTMSLASPLNMNANSATNVIFPASSNALLIVGADQPTAQQRPTLVSTSGSSSGSTSSISTTPNTSSTVSPVTCMTGPCLGSSQERAMMLGNRFSHLGMGLSPPVVSTSTSKSEPFFKPHPTVCNNPIFALPSIGNCSLNISSMPNTSRNPIGANPRDINNPLSINQLTKRREYKNVELIEASESKTIVAHAATSIIQHVAVNGYHANHSLLNSNLGHLHHQLNNRTENPNRSEQTMLSVSNHSVNSSECHKESDSQAIVSSNPPNAGSSDNGVISVS

PAN

Transcription factor PERIANTHIA

452 amino acids

Transcriptional activator involved in the determination of floral organ number. Acts to determine floral organ patterning by establishing floral organ primordia in specific numbers and positions. Plays a role in regulating stem cell fate by directly controlling AG expression. Binds to the 5'-AAGAAT-3' cis-acting element found in AG promoter. Might represent a target for a post-translational modification by GRXC7/ROXY1.

Belongs to the bZIP family.

50.458 kDa

MQSSFKTVPFTPDFYSQSSYFFRGDSCLEEFHQPVNGFHHEEAIDLSPNVTIASANLHYTTFDTVMDCGGGGGGGLRERLEGGEEECLDTGQLVYQKGTRLVGGGVGEVNSSWCDSVSAMADNSQHTDTSTDIDTDDKTQLNGGHQGMLLATNCSDQSNVKSSDQRTLRRLAQNREAARKSRLRKKAYVQQLENSRIRLAQLEEELKRARQQGSLVERGVSADHTHLAAGNGVFSFELEYTRWKEEHQRMINDLRSGVNSQLGDNDLRVLVDAVMSHYDEIFRLKGIGTKVDVFHMLSGMWKTPAERFFMWLGGFRSSELLKILGNHVDPLTDQQLIGICNLQQSSQQAEDALSQGMEALQQSLLETLSSASMGPNSSANVADYMGHMAMAMGKLGTLENFLRQADLLRQQTLQQLHRILTTRQAARAFLVIHDYISRLRALSSLWLARPRD

pan

Proteasome-activating nucleotidase

436 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

48.918 kDa

MGDILRDTADPQTPEELCRLYRSLTEQLRDQLQRIETDKQDLESQMLERISSLESRNLELREQIRQAEADKRYIETQKIRYEREVRKLKSESEQLRSPPLIIGTVVDVVDANRVIVRSSAGPRFLVRSSPSVNPDDIKPGARCTLNQQSLAIVELLPSSFDAQVYGMELVDSPQECYTDIGGLKEQINEVREAVELPLKRPELFTQIGIEPPKGVLLYGPPGTGKTLLAKAVAHETNAHFMRVVGSELVQKYIGEGARLVRELFDLAKKKAPTIIFIDEIDAVGASRTEANTSGDREVQRTLMQLLAGMDGFETRGDVKIIGATNRIDILDKALLRPGRFDRIIEIPLPDEEGRLSILKVHTRTLTMEETVNLPEIAGLTEGKNGADLRAICMEAGMYAIRNERPAITREDFLSAIEKVRLDFSHSPTDSEGRMFA

pan

Proteasome-activating nucleotidase

436 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

49.767 kDa

MEETGVKDVRDLCEKFLDFKREKERLEELLKEYFKRLEELERKLRAHEEKLRIEARRRKTLEKELEMERDEKAELREELRRKEVMIEKLRSDLQRMKKPPLIVGTVEEILDDGRVIVKSSTGPKFVSNVSPTVDRNELEPGANVALNQQSMAVVDVLPSEKDSRVLAMEVDESPDVSYDDIGGLDEQIREIREVVEKPLKEPELFEKVGVEPPKGVLLYGPPGTGKTLLAKAVANHADATFIRLAAPELVQKFIGEGARLVRELFELAREKAPSIIFIDEIDAIGARRMRDATSGDREVQRTLTQLLAEMDGFDPLDDIKVIAATNRKDILDPALLRPGRFDRHIKIPLPDEEGRYEIFKIHTRDMNLAEDVDLQKLAKITEGASGADIKAICTEAGMMAIREDRDIVTMDDFLKAVDRVMGKKEEESGEFKRAYH

pan

Proteasome-activating nucleotidase

430 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates. In addition to ATP, is able to cleave other nucleotide triphosphates such as CTP, GTP and UTP, but hydrolysis of these other nucleotides is less effective in promoting proteolysis than ATP. Moreover, PAN by itself can function as a chaperone in vitro.

Belongs to the AAA ATPase family.

48.69 kDa

MVFEEFISTELKKEKKAFTEEFKEEKEINDNSNLKNDLLKEELQEKARIAELESRILKLELEKKELERENLQLMKENEILRRELDRMRVPPLIVGTVVDKVGERKVVVKSSTGPSFLVNVSHFVNPDDLAPGKRVCLNQQTLTVVDVLPENKDYRAKAMEVDERPNVRYEDIGGLEKQMQEIREVVELPLKHPELFEKVGIEPPKGILLYGPPGTGKTLLAKAVATETNATFIRVVGSELVKKFIGEGASLVKDIFKLAKEKAPSIIFIDEIDAIAAKRTDALTGGDREVQRTLMQLLAEMDGFDARGDVKIIGATNRPDILDPAILRPGRFDRIIEVPAPDEKGRLEILKIHTRKMNLAEDVNLEEIAKMTEGCVGAELKAICTEAGMNAIRELRDYVTMDDFRKAVEKIMEKKKVKVKEPAHLDVLYR

pan

Proteasome-activating nucleotidase

421 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

46.965 kDa

MRSHLVKPGSVYDGIEPGELGESTESVQDRVRQLESRNSFLEEQCSQIESEKRYLENQKIKYEREIRKLQSELDRMKTSPLIIGTVIDVIKNDRIIVRSSNGPQFLVNVSQYIDEKKLLPGAKVALNQHTLAIAEVIPSTEEPFVAAMEVIESIEVDYDQIGGLDEQIQELQEAVELPLIEPERFARIGIEPPKGVLLYGLPGTGKTLLAKAVAHRTNATFIRVVGSELVQKYIGDGSKLVREIFEMARKKAPSIIFIDELDSIAARRLNETTGADREVQRTLMQLLAEMDGFDKRKNIRIIAATNRPDVLDPAILRPGRFDRLVHVPMPGIEARGKILKIHCGKMTLAGDIDFKKLAKVTEGMSGADLKAIATEAGMFAVRKDKALVEMEDFLEAVEKVSMAADTQKMMPGNLPETTMFV

pan

Proteasome-activating nucleotidase

420 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

47.056 kDa

MRSHLVKPGSVYDGIEPGELGETTESVQDRVRQLESRNSFLEEQCSQIESEKRYLENQKIKYEREIRKLQSELDRMKTSPLIIGTVIDVIKNDRIIVRSSNGPQFLVNVSQYIDEKKLLPGAKVALNQHTLAIAEVIPSTEEPFVAAMEVIESVEVDYDQIGGLDEQIQELQEAVELPLTSPERFARIGIEPPKGVLLYGLPGTGKTLLAKAVAHRTNATFIRVVGSELVQKYIGDGSKLVREIFEMARKKAPSIIFIDELDSIAARRLNETTGADREVQRTLMQLLAEMDGFDKRKNIRIIAATNRPDVLDPAILRPGRFDRLVHVPMPGIEARGKILKIHCEKMTLAEDIDFKKLAKATEGMSGADLKAIATEAGMFAVRRDKELVEMEEFLEAVEKVSMAADTQKMMPSNLPETMFV

pan

Proteasome-activating nucleotidase

417 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

46.239 kDa

MQTILMAEGSGLDFTGEVPLSDFSKYLLDRVKQLEERNVRLKEEYRKIELEKKSVENKKVQYEREIRKLTSELDRLKTPPLIVGTILDVMANGKMIIKSSTGPKFVVNSSQFINSKEVYPGAKVALNQQSLAVIEVLPTVKDPSVLGMEVVDSPEIDYQSIGGLEAQINELKETVELPLLKPELFQKVGIEPPKGVLLYGPPGTGKTLLAKAVANRTKATFIRIIGSELVQKYIGEGARMVRELFELAKEKSPSIIFIDEIDSIGAKRLDSITSGDREVQRTLVQLLAEMDGFDPRGNVRILAATNRPDILDPALLRPGRFDRMIKVPMPTAEAREQILKIHARKMNLADDVDLRKIALITDESSGADLSAIVMEAGMFAIRNNRDVVDSSDFNAAVAKVMGERNRSMAQESGVMFA

pan

Proteasome-activating nucleotidase

412 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

46.218 kDa

MAEAARHPDDMKTPDELYRYLVDRVAGMESQNQELKEQIRQLESDKRYIETQKIRYEREVRKLKSEIEHLKTPPLIVGTITDIIDSGRVVVRSSAGPRFLVRVSQAVNPTTLKAGVRCTLNQQSLAIVEVLPSTYDSQVYGMELVDAPTETYEDIGGLEKQIMEIREAVELPMTRPDLFEKIGINPPKGVLLYGPPGTGKTLLAKAVAHETHAIFLHTVGSELVQKYIGEGARLVRELFDLAKEKAPSIVFIDEIDAIGASRTEAMTSGDREVQRTLMQLLAAMDGFEPRGDVKIIGATNRIDILDAALLRPGRFDRIIEIPLPDTEGRYSILKVHTRCMNLSEDVDLMEVARLTEGRNGAELNAICMEAGMFAIRKEHPQVDQEDFLTALNKFRCDFERDHRLTTAGVMFA

pan

Proteasome-activating nucleotidase

412 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

46.681 kDa

MGDIARQAPDKDTGEDIYQYLLERITNLENRNLELREQFRQMESEKRYVETQKIRYERELRKLKSEIEQLRSPPLVIGTVTDVIDNSRVIVRSSAGPRFLVRTSQLIDPDLLKPGVRCTLNQQSLAIVDVLPTSYDAQIYGMELVESPEETYENIGGLEPQIEEIREAVELPLTKPQLFEKVGISPPKGVLLYGPPGTGKTLLARAVAHQTNAHFLRVVGSELVQKYIGEGARLVRELFDLAKQRAPSIIFIDEIDAIGAHRNDSTTSGDREVQRTLMQLLAEMDGFDNRGDVKIVAATNRIDILDRALLRPGRFDRMIEIPLPDHQGRLAILKIHTQYMNIGEDVNLSEVSRLTEGKNGADLRAICMEAGMFAIRMERDAVNSEDFMKAIDKLALDFDRHHFHTTFGEMFA

pan

Proteasome-activating nucleotidase

412 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

46.506 kDa

MADTLNHLPEPQKGEDLYRYLLERVTNLEDRNTELREQLRQIEADKRYLETQKVRYEREVRKFKGEIEQMKSPPLVIGTVTDLIDENRVIVRSSAGPRFLVGISQSLNIEEIKPGARCTLNQQSLAIVEILPTNYDAQIYGMEVIEAPSERYEEIGGLEKQINEIREAVELPLKKPEVFRKMGIEPPKGVLLHGPPGTGKTLLARAVAHQTEAHFLRVVGSELVQKYIGEGARLVRELFELAKKKSPSIIFIDEIDAIGASRTESNTSGDREVHRTLMQLLAEMDGFSNRGDVRIIGATNRIDILDRALLRPGRFDRIIEIPAPDIEGRVSILNIHCAGMNIDKKVDIRDIATRTDGKNGADLRSICMEAGMFAIRSDHEMVTLEDFEQSIEKFSNDFERDSLINTSGAMFA

pan

Proteasome-activating nucleotidase

410 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

46.111 kDa

MENNSQNVLKKIEDLKKEVRMLKEENSKTKRNLMWKIRKLEKDKLLIENERTRLDREVKSLRGEIERFRTPPLVIATVTEVLDDHRVAVKSTTGPHFVINYSRFIDRKQLEPGARVALNQQTFSIVDVLPSEKDPVVTGMEVEEKPDVSYEQIGGLEEQVREVKETVELPLKKPELFEKIGIEPPKGVLLYGPPGTGKTLLAKAVAHETNATFIKIVASEFVRKYIGEGARLVRGVFELAKEKSPSIIFIDEIDAVAAKRLKSSTSGDREVQRTLMQLLAELDGFESRGNVGIVAATNRPDILDPALLRPGRFDRFIEVPLPNEDGRREILKIHTSGMALAEEVDIELLARITDGASGADLKAICTEAGMFAIRDERDEVTMADFMDAVDKIMGVEKEEEYKQETGVMFG

pan

Proteasome-activating nucleotidase

409 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

44.684 kDa

MTLSSAGGSRSHRHNGGHSERDVEIRILKDKVRSLTKEKISLQKELEYYKNEITKLLSPPYIEAVVLEVIDDNRVVVKSSTGPNLIVNVAAGVDARSLKPGAIVALNNRGSTIVDVLPGRYDPLVKAMEVEERPKVFFKDVGGLEEQIREIYEAVVLPIKNPHLFRELGIDPPKGVLLHGPPGTGKTLLAKAVAGETEATFIRVVGSELVNKFIGEGARLVREIFRLAREKAPSILFIDEIDAIASKRVDIGTSGDREVQRTMLQLLAELDGFDPLDNVKVIAATNRLDLIDPAVLRPGRFDRIIEVPLPSLRGRLEILGIHTRKAKMAPDVDLEAIAKLTEGFSGADLKAVVVEAGYNAIRRGSRVITMDDMIKAVEKVKAALDKRGGGDPFIRAQQKSGDDTIATVI

pan

Proteasome-activating nucleotidase

407 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

45.839 kDa

MSYPDDYSTDIEKNKMDLKEFKEKTQIAELESKVLRLELKNKDISRENVQIKKENEILKRELDKLRIPPLILGTILDRVNERKAVVKSSTGPNFLVNLSQFVDPDDIVPGARVCLNQQTLAIVEVLPKEKDYRAMAMEIEEKPDISFEDIGGLNNQIRDIKEVVELPLKNPELFEKVGIVPPKGVLLYGPPGTGKTLLAKAVAYETNASFVRVVGSELVKKFIGEGAKLVRDVFKLAKEKSPCIIFIDEIDAVASKRTESLTGGDREVQRTLMQLLAEMDGFDSRGDVKIIAATNRPDILDPAILRPGRFDRIIEISMPDEDGRLDILKIHTEKMNLKGVDLREVAKIAENMVGADLKAVCTEAGMFAIREEREFIKMDDFREAITKITGKKEKCSYDMPQLTVMYG

pan

Proteasome-activating nucleotidase

407 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

45.797 kDa

MSYPDDYSTDVEKNKMDLKEFKEKTQIAELESKVLRLELKNKDISRENVQIKKENEILKRELDKLRIPPLILGTILDRVNERKAVVKSSTGPNFLVNLSQFVDPEDIVPGARVCLNQQTLAIVEVLPKEKDYRAMAMEIEEKPDISFEDIGGLNNQIRDIKEVVELPLKNPELFEKVGIVPPKGVLLYGPPGTGKTLLAKAVAYETNASFVRVVGSELVKKFIGEGAKLVRDVFKLAKEKSPCIIFIDEIDAVASKRTESLTGGDREVQRTLMQLLAEMDGFDSRGDVKIIAATNRPDILDPAILRPGRFDRIIEISMPDEDGRLDILKIHTEKMNLKGVDLREVAKLAENMVGADLKAVCTEAGMFAIREEREFIKMDDFKEAISKITGKKEKCSYDMPQLTVMYG

pan

Proteasome-activating nucleotidase

407 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

45.854 kDa

MSYPDDYSTDIEKNKMDLKEFKEKTQIAELESKVLRLELKNKDVTRENVQIKKENEILKRELDKLRIPPLILGTILDKVNERKAVVKSSTGPNFLVNLSQFVDPEDIVPGARVCLNQQTLAIVEVLPKEKDYRAMAMEIEEKPDISFEDIGGLNNQIRDIKEVVELPLKNPELFEKVGIVPPKGVLLYGPPGTGKTLLAKAVAYETNASFVRVVGSELVKKFIGEGAKLVRDVFKLAKEKSPCIIFIDEIDAVASKRTESLTGGDREVQRTLMQLLAEMDGFDSRGDVKIIAATNRPDILDPAILRPGRFDRIIEISMPDEDGRLEILKIHTEKMNLKNVDLREVAKLAENMVGADLKAVCTEAGMFAIREEREFIKMDDFKEAISKITGKKEKCSYDMPQLTVMYG

pan

Proteasome-activating nucleotidase

407 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

45.852 kDa

MSYPDDYSTDIEKNKMDLKEFKEKTQIAELESKVLRLELKNKDINRENVQIKKENEILKRELDKLRIPPLILGTILDKVNERKAVVKSSTGPNFLVNLSQFVDPEDIVPGARVCLNQQTLAIVEVLPKEKDYRAMAMEIEEKPDISFEDIGGLNNQIRDIKEVVELPLKNPELFEKVGIVPPKGVLLYGPPGTGKTLLAKAVAYETNASFVRVVGSELVKKFIGEGAKLVRDVFKLAKEKSPCIIFIDEIDAVASKRTESLTGGDREVQRTLMQLLAEMDGFDSRGDVKIIAATNRPDILDPAILRPGRFDRIIEISMPDEDGRLEILKIHTEKMNLKGVDLREVAKIAENMVGADLKAVCTEAGMFAIREEREFIKMDDFREAISKITGKKEKCSYDMPQLTVMYG

pan

Proteasome-activating nucleotidase

407 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

45.568 kDa

MTYPDDYSTDVQKNEMDLKEFKEKAYLAELESKVLRLELKNKDITRENVQIKKENEILKRELDKLRIPPLILGTVLDRVNERKAVVKSSTGPNFLVNLSQFVEPDDIVPGARVCLNQQTLAVVEVLPKEKDYRAMAMELEEKPDILFGDIGGLNNQIRDIKEVVELPLKNPELFEKVGIVPPKGVLLYGPPGTGKTLLAKAVARETNASFVRVVGSELVKKFIGEGAKLVRDVFKLAKEKSPCIIFIDEIDAVASKRTESLTGGDREVQRTLMQLLAEMDGFDSRGDVKIIAATNRPDILDPAILRPGRFDRIIEIAAPDEDGRLEIFKIHTDKMNIKSVDLREIAKMAENMVGADIKAVCTEAGMFAIREGREYVTTKDFKEALLKVTGKKEKSEEGIAHLTTMYG

pan

Proteasome-activating nucleotidase

399 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

45.177 kDa

MSVMSGDEVQFQGDYDDYITYLKRRIRQLELQVRMLEADKERLERELSRLRSEMSRLRQPPAFAGTVIEVLDEDRAIVQNYNGPRFVVRIAPWIDRKKLRPGTRVALDQRTMAVVEILPTSKDPTVLGFEVIERPNVTYNDIGGLKKQLQELREAIELPLKHPELFEEVGIDPPKGVLLYGPPGCGKTLMAKALAHEVNATFIRVVGSELVRKYIGEGARLVHELFELAKEKAPTIIFIDEIDAIGAKRMDETTGGEREVNRTLMQLLAEMDGFDPRGNVKVIAATNRPDILDPALLRPGRFDRLIEVPLPDFEGRLEILKVHTRRMKLKGVDLRAIAEMTEGASGADLKAIATEAGMFAIRERRTYVTQEDFLKAVDKVLGNERKLLQQITSHEVIYG

pan

Proteasome-activating nucleotidase

398 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates (Probable).

Belongs to the AAA ATPase family.

44.964 kDa

MGDSEIQYLLEKLKKLEEDYYKLRELYRRLEDEKKFIESERIRYEREVRRLRSEVERLRSPPLLVGVVSDILEDGRVVVKSSTGPKFVVNTSQYINEEELKPGARVALNQQTLAIVNVLPTSKDPMVYGFEVEEKPEVSYEDIGGLDVQIEEIREAVELPLLKPELFAEVGIEPPKGVLLYGPPGTGKTLLAKAVANQTRATFIRVVGSEFVQKYIGEGARLVREVFQLAKEKAPSIIFIDELDAIAARRTNSDTSGDREVQRTMMQLLAELDGFDPRGDVKVIGATNRIDILDPAILRPGRFDRIIEVPLPTFEGRIQIFKIHTRKMKLAEDVDFKELARITEGASGADIKAICTEAGMFAIREERAKVTMLDFTKAIEKVLKKTTPIPDLKGVMFV

pan

Proteasome-activating nucleotidase

398 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

45.091 kDa

MSIEDVGIKPSEEYDDYIMYLKKRIRQLELQVRTLEADKERLERELSRLRMEMSRLRQPPAFAGTLIELLDEDRAIVQNYNGPRFVVRIAPWIERENLKPGARVALDQRTMAIVELLPSEKDPSVLGFEVIERPTVSYNDIGGLDKQLQELREAIELPLKHPELFEKVGIEPPKGVLLYGPPGCGKTLMAKALAHEVNATFIRVVGSELVRKFIGEGARLVHELFELAKEKAPAIIFIDEIDAIGAKRMDETTGGEREVNRTLMQLLAEMDGFDPSGNVKIIAATNRPDILDPALLRPGRFDRLIEVPLPNFKSRLEILKIHTKRMNLKGVDLRIIAEMTEGASGADLKAITMEAGMFAIRDRREYVTQEDFLKAIEKVLGSEQRLSQQIAMHEVMYG

pan

Proteasome-activating nucleotidase

397 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

44.757 kDa

MGSFDEVSHDTGYEDYITFLKRRIRQLELQVRTLEADKERLERELSRLRTEMSRLRQPPAFAGTVIEVLDDDRAIVQNYNGPRFVVRIAPWIERDKLKPGSRVALDQRTMAIVELLPTEKDPSVLGFEVIEKPRVTYQDIGGLERQLAELREAVELPLKHPELFEKVGIEPPKGVLLYGPPGCGKTLMAKAVANHVNATFIRVVGSELVRKFIGEGARLVHELFEMAKEKAPTIIFIDEIDAIGAKRMDETTGGEREVNRTLMQLLAEMDGFDPRGNVKVIAATNRPDILDPALLRPGRFDRLIEVPLPDFRGRLEILKVHTRKMNLRNVDLSIIADITEGASGADLKAIATEAGMFAIRDRRTYVTQEDFLKAVDKVLGAEKRLAQAIAMHEVMYG

pan

Proteasome-activating nucleotidase

397 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

44.845 kDa

MSIENTDVHPEGYDDYVTFLKRRIRQLELQVRTLEADKERLERELSRLRMEMSRLRQPPAFAGNVIEVLDDERAIVQNYNGPRFVVRIAPWIERDKLKPGARVALDQRTMAIVELLPSEKDPSVLGFEVIERPKVTYNDIGGLEKQLQELREAIELPLKHPELFEQVGIEPPKGVLLYGPPGCGKTLMAKAVANHVNATFIRVVGSELVRKFIGEGARLVHELFELAKEKAPTIIFIDEIDAIGAKRMDETTGGEREVNRTLMQLLAEMDGFDPRGNVKVIAATNRPDILDPALLRPGRFDRLIEVPLPDYQGRLEILKVHTRKMNLKGVDLRVIAEITEGASGADLKAIATEAGMFAIRDRRTYVTQDDFLKAVDKVIGSEKRLAQQIAMHEVMYG

pan

Proteasome-activating nucleotidase

396 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

44.992 kDa

MSGDEVQFHENYDDYITYLKRRIRQLELQVRMLEADKERLERELSRLRSEMSRLRQPPAFAGTVIEVLDDDRAIVQNYNGPRFVVRIAPWIERDKLRPGARVALDQRTMAIIELLPSSKDPTVLGFEVIERPNVTYNDIGGLKKQLQELREAIELPLKHPELFEEVGIDPPKGVLLYGPPGCGKTLMAKALAHEVNATFIRVVGSELVRKYIGEGARLVHELFELAKEKAPTIIFIDEIDAIGAKRMDETTGGEREVNRTLMQLLAEMDGFDPRGNVKVIAATNRPDILDPALLRPGRFDRLIEVPLPDFEGRLEILKVHTRRMKLKNVDLRVIAEITEGASGADLKAIATEAGMFAIRERRTYVTQEDFLKAVDKVLGNERKLLQQITSHEIIYG

pan

Proteasome-activating nucleotidase

396 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

44.805 kDa

MSEDEAQFHGNYDDYVTYLKRRIRQLELQVRMLEADKERLERELSRLRSEMSRLRQPPAFAGSVIEVLDDDRAIVQNYNGPRFVVRIAPWIDKSKLRPGTRVALDQRTMAIIEILPASKDPAVLGFEVVERPNVTYNDIGGLKKQLQELREAIELPLKHPELFEEVGIDPPKGVLLYGPPGCGKTLMAKAIAHEVNATFIRVVGSELVRKYIGEGARLVHELFELAKEKAPTIIFIDEIDAIGAKRLDETTGGEREVNRTLMQLLAEMDGFDPRGNVKVIAATNRPDILDPALLRPGRFDRLIEVPLPDFEGRLEILKVHTRRMKLRGVDLRLIAELTEGASGADLKAIATEAGMFAIRERRTYVTQEDFLKAIDKVLGNEKKIIQQIMSHEVIYG

pan

Proteasome-activating nucleotidase

393 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

44.142 kDa

MSGDFDTIRDASSPDEVQLVRLLEEKIKSLQIEIENLRKELNYYKAEMEKMLSPPLIEAVVLDVLPDGRVLVRSSSGPNLVVNIASHIDQKLIKPGISVALNQRGSTILEVLPQKEDPIVKTMEIIERPNVTYSEIGGLEEQIRELREVVELPLKNPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFDPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFKGRTEIFNIYLKKMKIEDNINLELLSQLTEGFSGADIKNVCVEAAYMAIRDGRNKVTMNDLVEAINKINVKRNKMESMKERREKYS

pan

Proteasome-activating nucleotidase

393 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

44.02 kDa

MSGDFDTIRDASSSDEVQLVRLLEEKIKSLQIEIENLRKELNYYKAEMEKMLSPPLIEAVVLDVLPDGRVLVRSSSGPNLVVNVASHIDQKLIKPGVSVALNQRGSTILEVLPQKEDPIVKTMEIVEKPNVTYSEIGGLEEQIKELREVVELPLKKPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFNPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFRGRTEIFNIYLKKMKVEDNINLELLSQLSEGFSGADIKNVCVEAAYMAIRDGRNKVTMKDLVDAITKINVKRNNMESMKERREKYS

pan

Proteasome-activating nucleotidase

393 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

44.02 kDa

MSGDFDTIRDASSSDEVQLVRLLEEKIKSLQIEIENLRKELNYYKAEMEKMLSPPLIEAVVLDVLPDGRVLVRSSSGPNLVVNVASHIDQKLIKPGVSVALNQRGSTILEVLPQKEDPIVKTMEIVEKPNVTYSEIGGLEEQIKELREVVELPLKKPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFNPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFRGRTEIFNIYLKKMKVEDNINLELLSQLSEGFSGADIKNVCVEAAYMAIRDGRNKVTMKDLVDAITKINVKRNNMESMKERREKYS

pan

Proteasome-activating nucleotidase

393 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

44.02 kDa

MSGDFDTIRDASSSDEVQLVRLLEEKIKSLQIEIENLRKELNYYKAEMEKMLSPPLIEAVVLDVLPDGRVLVRSSSGPNLVVNVASHIDQKLIKPGVSVALNQRGSTILEVLPQKEDPIVKTMEIVEKPNVTYSEIGGLEEQIKELREVVELPLKKPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFNPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFRGRTEIFNIYLKKMKVEDNINLELLSQLSEGFSGADIKNVCVEAAYMAIRDGRNKVTMKDLVDAITKINVKRNNMESMKERREKYS

pan

Proteasome-activating nucleotidase

393 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

44.02 kDa

MSGDFDTIRDASSSDEVQLVRLLEEKIKSLQIEIENLRKELNYYKAEMEKMLSPPLIEAVVLDVLPDGRVLVRSSSGPNLVVNVASHIDQKLIKPGVSVALNQRGSTILEVLPQKEDPIVKTMEIVEKPNVTYSEIGGLEEQIKELREVVELPLKKPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFNPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFRGRTEIFNIYLKKMKVEDNINLELLSQLSEGFSGADIKNVCVEAAYMAIRDGRNKVTMKDLVDAITKINVKRNNMESMKERREKYS

pan

Proteasome-activating nucleotidase

393 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

44.019 kDa

MSGDFDTIRDASSSDEVQLVRLLEEKIKSLQIEIENLRKELNYYKAEMEKMLSPPLIEAVVLDVLPDGRVLVRSSSGPNLVVNVASHIDQKLIKPGVSVALNQRGSTILEVLPQKEDPIVKTMEIVEKPNVTYSEIGGLEEQIKELREVVELPLKKPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFNPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFRGRTEIFNIYLKKMKVEDNINLELLSQLSEGFSGADIKNVCVEAAYMAIRDGRNKVTMKDLVNAITKINVKRNNMESMKERREKYS

pan

Proteasome-activating nucleotidase

393 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

44.02 kDa

MSGDFDTIRDASSSDEVQLVRLLEEKIKSLQIEIENLRKELNYYKAEMEKMLSPPLIEAVVLDVLPDGRVLVRSSSGPNLVVNVASHIDQKLIKPGVSVALNQRGSTILEVLPQKEDPIVKTMEIVEKPNVTYSEIGGLEEQIKELREVVELPLKKPEIFREIGVEPPKGVLLYGPPGTGKTMLAKAVATESNAVFIHVVASEFAQKFVGEGARIVRELFEMAKRKAPSIIFIDEIDAIGAKRIDIGTSGEREIQRTLMQLLAELDGFNPLDNVKIIAATNRIDILDPALLRPGRFDRIIEVPLPDFRGRTEIFNIYLKKMKVEDNINLELLSQLSEGFSGADIKNVCVEAAYMAIRDGRNKVTMKDLVDAITKINVKRNNMESMKERREKYS

pan

Proteasome-activating nucleotidase

392 amino acids

ATPase which is responsible for recognizing, binding, unfolding and translocation of substrate proteins into the archaeal 20S proteasome core particle. Is essential for opening the gate of the 20S proteasome via an interaction with its C-terminus, thereby allowing substrate entry and access to the site of proteolysis. Thus, the C-termini of the proteasomal ATPase function like a 'key in a lock' to induce gate opening and therefore regulate proteolysis. Unfolding activity requires energy from ATP hydrolysis, whereas ATP binding alone promotes ATPase-20S proteasome association which triggers gate opening, and supports translocation of unfolded substrates.

Belongs to the AAA ATPase family.

43.967 kDa

MSDELDSYRAKHYNSDDPIVRLLEEKIESLTKELEKLRQDLNWYKGELEKLLAPPYIEAIVLDILPDGKVIVRSSSGPNLIVNVSSNIDIKKLKPGSLVALTQRGSTIVEVLPEREDAYVKSFEVIEKPNVHYSDIGGLNEQINEIREVIELPLKNPELFKEIGIDPPKGVLLYGPPGTGKTLLAKAVATESNATFIQVVASEFAQKFVGEGARIVREVFELARRKAPSIVFIDEIDAIGAKRVDMGTSGEREIQRTLMQLLAEIDGFKPLDNVKIIAATNRLDILDPALLRPGRFDRLIEVPLPNFEGRKEIFRIYLQKMKTDGNIRYDILASMTEGFSGAEIKNVCTEAGYIAIRNGRKYVNMTDLITAIEKIKAKNNKAKNTDRTEKYV