About Services Proteins Contact

pYV0051

Gene
pYV0051
Protein
Uncharacterized protein pYV0051
Organism
Yersinia pseudotuberculosis serotype I (strain IP32953)
Length
107 amino acids
Mass
12.717 kDa
Sequence
MKRYQFTDADSSWQLDEIYIRVNGKWFYLYRAINKHGTTLDFYFSPKRNKNTAYPFIKRVLKTYSVERQPKILNTDKHSSYGYAITRLMKEGKDTRCCKAAASQIPE