About Services Proteins Contact

ortA

Gene
ortA
Protein
2-amino-4-ketopentanoate thiolase alpha subunit
Organism
Acetoanaerobium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIMB 10654)
Length
101 amino acids
Function
Involved in the ornithine fermentation pathway. Catalyzes the thiolytic cleavage of 2-amino-4-ketopentanoate (AKP) with coenzyme A (CoA) to form acetyl-CoA and alanine. It is strictly specific for AKP.
Similarity
Belongs to the OrtA family.
Mass
11.569 kDa
Sequence
MAKKGDWVLIHKIVLSPEERAPQVPDDTKKVPLEMWIKGYLNEDAQIGDQVSITTRTKRVEEGKLLEVNPYYTHDFGKFVPELLKISEQVREITFGGEGNE

Gene
ortA
Protein
2-amino-4-ketopentanoate thiolase alpha subunit
Organism
Unknown prokaryotic organism
Length
101 amino acids
Function
Involved in the ornithine fermentation pathway. Catalyzes the thiolytic cleavage of 2-amino-4-ketopentanoate (AKP) with coenzyme A (CoA) to form acetyl-CoA and alanine. It is strictly specific for AKP.
Similarity
Belongs to the OrtA family.
Mass
11.492 kDa
Sequence
MSEKCKKDDWVEIHYVVLEARERTGDIPEDTRKVPLECWIKGWAEKEGTVGEEVTIRTPANRYVKGTLTRINPEYTHTFGPCASELSAIGQELRATLKEGK