ORC6

Origin recognition complex subunit 6

435 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. It has a role in both chromosomal replication and mating type transcriptional silencing. Binds to the ARS consensus sequence (ACS) of origins of replication.

Belongs to the ORC6 family.

50.296 kDa

MSMQQVQHCVAEVLRLDPQEKPDWSSGYLKKLTNATSILYNTSLNKVMLKQDEEVARCHICAYIASQKMNEKHMPDLCYYIDSIPLEPKKAKHLMNLFRQSLSNSSPMKQFAWTPSPKKNKRSPVKNGGRFTSSDPKELRNQLFGTPTKVRKSQNNDSFVIPELPPMQTNESPSITRRKLAFEEDEDEDEEEPGNDGLSLKSHSNKSITGTRNVDSDEYENHESDPTSEEEPLGVQESRSGRTKQNKAVGKPQSELKTAKALRKRGRIPNSLLVKKYCKMTTEEIIRLCNDFELPREVAYKIVDEYNINASRLVCPWQLVCGLVLNCTFIVFNERRRKDPRIDHFIVSKMCSLMLTSKVDDVIECVKLVKELIIGEKWFRDLQIRYDDFDGIRYDEIIFRKLGSMLQTTNILVTDDQYNIWKKRIEMDLALTEPL

orc6

ORC1-type DNA replication protein 6

374 amino acids

Involved in regulation of DNA replication.

Belongs to the CDC6/cdc18 family.

41.72 kDa

MDEDPEEGLLGWGETVFRDEHVFEIDYVPEVFRHRESQLQTLQYALRPAVRGSRPLNVVARGPPGTGKTTAVQKLFGELSGQPGVQTVRVNCQVDSTRYAVFSRVFEEIFDYEPPSSGISFKKLFGQVAERIADDDEVLVVALDDVNYLFYEDEAGDTLYSLLRAHETQPGAKVGVVVVSSDLELDVIEALDGRVQSVFRPEEAYFSAYDRAEITDILRDRVEVGFREGAVAEPVLDAVGGRTDEAGDLRVGIDVLRRAGLHAESRASKTVEMEDVDAVYEDAKHVHLSRTLAALSDNERALVRTVAEQEGDRAGDVYDVFNDRTDLGYTRYTEIVNKLDELGVIDAAYEQRSGRGRSRTLRLTHDSEAVLERL

ORC6

Origin of replication complex subunit 6

295 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.

Belongs to the ORC6 family.

32.606 kDa

MDMSSIASRLGLSGSRPVVRKAAELRRLCDVTFDSSVLGIGEVCKAIICLEIAASKFQVIFDRAEAVRMSGMSEKAYIRSFNALQNGLGVKTTLDVRELGIQFGCVRLIPFVQKGLSLYKERFLAALPPSRRASTDFGRPVFTAAAFYLCAKRHKLKVDKLKLIDLCGTSSSEFTTVSTSMADLCFDVFGIAKEKKDAKSIKGSRELLDVLPSKRKHDDDSDSSGESSGDDQDELDLPTYKRHKKMEKEAYNDWKSSVLSNKQTKPDPAKPRKQAQLNFKKKPSDMALEVSSAAN

ORC6

Origin of replication complex subunit 6

284 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.

Belongs to the ORC6 family.

31.77 kDa

MDISDIGRKLSLDNNKLLIRKAAEIRRLCDAQFDSSIIGVGEICKAVICLEIAATRLQIIFDRQAAVKLSGMSEKAYSRSFNSLQNVIGIKIKLNVRELAVQFGCVRVIKSVQNVLSSYKERFLASLPASRRANADFTRPVFTAAAFYLCAKKQKLKVDKLRLIEVCGTSESEFSCVSTSMTDLCFDCVGISKEKKDAKDVKGNRDLLDVLPGKRRLEDGGYSSGDESSCYKRHKKMEEAKYEDWKSTVVNSIKKNPEKGTKRVIQASLNFPKKSETKELQVDS

orc6

Origin recognition complex subunit 6

264 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. It has a role in both chromosomal replication and mating type transcriptional silencing. ORC binds to multiple sites within the ars1 origin of DNA replication in an ATP-independent manner.

Belongs to the ORC6 family.

30.703 kDa

MERQQIIESLRRIIPTESTEYNERLISLGESFLEWSKYKHNLKATEELCRPYMAAHLACELLSNDLNLEINLLATPIPKKKYYKLFTYFQEILSPLTKSLAAKDDLMETITYLCTKLGGSTAIPYVKQLVKAVVTNDMRIEHKRGIIIAAYLLVSAKAFGKDELHINHTERRKAQSVLQDTSSALQIQYWMHVLSESWQYKEIPLNGIEGYESQKQRIKPWSGIASMIQIDYEKRLQNYPIWKACIEERIQYYKSQLEKDGTAS

Orc6

Origin recognition complex subunit 6

262 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication (By similarity).

Belongs to the ORC6 family.

29.188 kDa

MESELVRRLAPRLGLAEPSVLRKAEEFLRLSKVKCVSLSARSSETSNAVICLDLAASCRKCPLDRAYLIRLSGLNKMMYQSCLKSFECLLGLNSNVGIRDLAVQFSCTEAVNLAAEILQSYKSGLPETQRADLDLSRPLFTTAALLSACKILKIKVDKTKMITTSGVKKAILDRLCKQLEKIGQQINRDSADLARPALKRKKPEFSPTLKKKEPGLEPPAKEIEVIETLHKLPKDEDLTQDYEEWKRKILENAAKAQTATAE

Orc6

Origin recognition complex subunit 6

257 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication (By similarity).

Belongs to the ORC6 family.

29.239 kDa

MTTLIEQLITKMGLREEPNVLEKTTELVRLLELRSTNVPLQINEYGKIVLCADLASCMIGIAFDKEQALKLSGLRKSQYLNNKRMFEKLLDLNKLASVNDICVQLGLNEVARKAEELMTLFKGVAATEDMGTDTSHPQYATMAVFQACRLLKKKVSKSKLMPFSNLRPSQFQLLEQQWERMIAKHHKESKVPSSTDMEGKLKENQNENIKGHEAKKAHKPPPEDYEIWKARMLAKAQAKLKELEASQSHMDSQLLEA

ORC6

Origin recognition complex subunit 6

252 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication (By similarity).

Belongs to the ORC6 family.

28.08 kDa

MESGLIRRLAPRLGIAEQEVLRKAEEYLRLSRVKCVGLSARTTETSNAVMCLDLAASCMKCPLDRAYLIKLSGLNKKMYQSCLKSFECLLGLNSNIGIRDLAVQFSCTEAVNLASKILQSYESSLPQTQQVDLDLSRPLFTTAALLSACKILKLKVDRNKMAATSGVKKAIFDRLCKQLEKIGQQIDREAGDSVTPPQKKKKTVIEPSAKEIENVVETLPKPQKDEDLTQDYEEWKRNILENAARAQKAATQ

ORC6

Origin recognition complex subunit 6

252 amino acids

Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication. Does not bind histone H3 and H4 trimethylation marks H3K9me3, H3K27me3 and H4K20me3.

Belongs to the ORC6 family.

28.107 kDa

MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIKLSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKSYESSLPQTQQVDLDLSRPLFTSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE