nuoI2

NADH-quinone oxidoreductase subunit I 2

264 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

28.065 kDa

MPQTVRAYTGAIRDTVKSFWHGLSITLSYLARRPTTVQYPDRTPMPVRDMLPPRYRGFLEVDSGICTGCQACERACPIGCIQISLEKDAANPKQRVVTQFDIDEAKCMFCGLCVEPCPTGSIQHTREFEGTHKHIRNLVFRWADPMNPFPVYKVDKNAEYYPRVPLGSLVRQRLETMAWDRSAPQFLPPEPPKPAEAKPAAKAAPAAKPAAAAPAAPAAAAPAAAPAPAKPAAAPAPAAAAAPAAPAAEAPAAPAAPAANPESK

nuoI2

NADH-quinone oxidoreductase subunit I 2

240 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

26.924 kDa

MGVTNFFGEAWRTGKSIVTGLGITFREMMFRPAITVFYPEQRDDVPPWFRGIPVLKTDLRTGEYKCTSCMQCAQACPVNVITIEWHQDPETKKKVCDRFAIDMSRCMLCNFCVEACPFDSLVMGYDYELCKVNPENLVFEFEDLLRLGLKYSKAEEPGPKATRSSTPPWVFHGLTNATEDDIQDIHGYLGRPPLPKGYEPELKPQFRKPAEEAAEAQQAEAAGQPAAEPGKTNGEEAGQP

nuoI2

NADH-quinone oxidoreductase subunit I 2

216 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

23.187 kDa

MAPIPGSGLAKGLAVTLRTMTKKTVTAQYPDAQPELPPRSRGVIGLFEENCTVCMLCARECPDWCIYIDSHKETVPPAAPGGRERSRNVLDRFAIDFSLCMYCGICIEVCPFDALFWSPEFEYAETDIHELTHERDKLREWMWTVPAPPALDPAAEEPKEIAAARKTAEKLAAAQAAAAQTDAAQAEAAQAEAAAEAGSAAEGAPDAAPKPQEGEA

nuoI2

NADH-quinone oxidoreductase subunit I 2

208 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

24.572 kDa

MIKKVAAKPLSWLERIFFIDFIKGLRITLKNALRKTITTHYPYEKITPPKRFRGYFAHKVVDGTEPQPAFQEWVNRYNILVEYGKSRCVVCLRCKRACPVPQLFEIEGKKLPNGKRVVSVFNMNMLLCTYCGFCVDACPVDCLYQTDIHENASYTRKDAVLTLEILEQIGRDWQRRREREPDRIWIDDEQRMKLWGENNVKLPKPEEV

nuoI2

NADH-quinone oxidoreductase subunit I 2

197 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

21.845 kDa

MAPVPGSGLAKGLAVTLRTMTRKTVTEQYPDAQPELPPRTRGVIGLFEENCTVCMLCARECPDWCIYIDSHKETVPAATPGGRDRSRNVLDRFAIDFALCMYCGICIEVCPFDALFWSPEFEYAETDIRDLTHERDKLREWMWTVPAPPALDPGAEEPKELAAARKAADKLAAQQQPDQPGPDHPGQPDESGQEGRT

nuoI2

NADH-quinone oxidoreductase subunit I 2

188 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

21.256 kDa

MSRAQDRIGTWIGWTFFADLANALTLTFGYMFSSPVTMQYPDTEKWLPYSRYRGHHFLKRDEEGEIKCVACELCARICPCDCIEVVPYEDEKGNRHPAKFEIDTARCLFCGLCEDACPADAIALGQQYEFSSFSSADLVIGRDDLLAKPGKAATGGGVVSARLNTKKDVLVETKEMQGYNWWRNIRRT

nuoI2

NADH-quinone oxidoreductase subunit I 2

188 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

21.361 kDa

MSRALDKAGRWIGWAFFADLANGLALTFGYMFSRPVTMQYPDKEKWLPYSRYRGHHFLKRDDEGEIKCVACELCARICPCDCIEVVPYEDEKGNRRPAKFEIDTARCLFCGLCEDACPADAIALGQQYEFSSFSSRDLVIGRDDLLAKPGKAMTGGGVVAARLNTERDVLVEASEPRGYNWWRNIRRK

nuoI2

NADH-quinone oxidoreductase subunit I 2

181 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

20.219 kDa

MAKFLDAVAGFGVTFASMFKKHVTEEYPEKPGPVAPRYHGRHQLNRYPDGLEKCIGCELCAWACPADAIYVEGADNTEELRYSPGERYGRVYQINYLRCIGCGLCVEACPTRALTMTNDYEMADDNRADLIYEKDRLLAPLLPEMTAPPHPRAPGATDKDYYLGNVTAHGLREAQRAGEPR

nuoI2

NADH-quinone oxidoreductase subunit I 2

178 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

20.034 kDa

MSSAWEAVRALASGFATTFVHLFRKPVTEEYPEVKRALPARTRAVIVLTRDPDGGERCVACYLCSAVCPVSCISMQAAEREDGRRHAAWFRINFARCIYCGLCEEACPTSAIQLTPFFETCERDILKLVYEKEDLLVDHQGKDKEYNFYKYAGVTTDVGGKGEHVQEDEPVDLRSNLP

nuoI2

NADH-quinone oxidoreductase subunit I 2

176 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

19.843 kDa

MPILTDFKAIATGLFVTWKHIFRRPVTVEYPEVKRTPAPRYRARIVLTRDPDGGERCVACYLCSAACPVDCISMEAAEGEEGRRYARWFRINFSRCIFCGLCAEACPTLAIQMTPDYEICERDIMELVYEKEDLLIDGCGKDAGYNFYRHAGIGVAQPRGAGECEEEPVDVRGLMP

nuoI2

NADH-quinone oxidoreductase subunit I 2

175 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

19.349 kDa

MGYLRNIGAIAKGMGITFSEMFKPTTVENYPDGPGVLRGAVFQERFRGMHVLQRDENGLEKCVACFLCAAACPSNCIYIEAAENTETNRVSGAERYAKVYNIDYNRCIFCGYCVEACPTDAITHGHGFELATFNASNLVYRKEQLLSGKPAHIGANEIFASDSREQQRLDQKAAK

nuoI2

NADH-quinone oxidoreductase subunit I 2

173 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

19.494 kDa

MIGFGWLEALLRVGRKLFVKPETQLYPEQKPKLYPRARGRIVLTRDPDGQERCVACNLCATVCPVGCIDLAKAVADDGRWYPEYFRVNFARCIFCGFCEDACPTAAIQLTPDYELSEWRRDALVYEKHDLLISGEGKVRGYRYWSVAGKAIPGKDKGEAEHEAPPVNLKGLLP

nuoI2

NADH-quinone oxidoreductase subunit I 2

171 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

19.063 kDa

MIGWLEALLRVGRKLAAKTVTVQYPEVKPQLPPRSRGRIVLTRDPDGQERCVACNLCAVACPVGCIDLSKAVAEDGRWYPEHFRINFARCIFCGYCEEACPTAAIQLTPDFELSEWRRDALVYDKKDLLIAGEGKVRGYRYWSVAGKAITGKDKGDAEHEAPPVDLKGLRP

nuoI2

NADH-quinone oxidoreductase subunit I 2

164 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

18.346 kDa

MKGILDSILRVGRMIFAPTKTVQYPEEKLPLAPRTRGRIVLTRDPDGQERCVACNLCAAACPVDCIDVVKAETPDGRWYPESFRINFARCIFCGYCEEACPTSAIQLTPDVELADYRRGFLQYEKEDLLISGEGKHPGYRYWDVAGKTIAGKAQDPVDPKDLCP

nuoI2

NADH-quinone oxidoreductase subunit I 2

164 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

18.316 kDa

MKGILDSILRVGRMIFAPTKTVQYPEEKLPLAPRTRGRIVLTRDPDGQERCVACNLCAAACPVDCIDVVKAETPDGRWYPESFRINFARCIFCGYCEEACPTSAIQLTPDVELADYRRGFLQYEKEDLLISGEGKHPGYRYWDVAGKAIAGKAQDPVDPKDLCP

nuoI2

NADH-quinone oxidoreductase subunit I 2

162 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

18.882 kDa

MNRIKDFFRTFLLFELIKGMMLTGRNMFARKITVYFPEEKTPQSPRFRGLHALRRYPNGEERCIACKLCEAVCPALAITIESEQREDGTRRTTRYDIDLTKCIFCGFCEESCPVDSIVETRILEYHGEKRGDLIYTKQMLLAVGDRYEEQIAKDRAADAGYR

nuoI2

NADH-quinone oxidoreductase subunit I 2

162 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

18.84 kDa

MNTLRSYIKSFLLWELLLGLKLTGRYLFTKKVTVQFPEERTPQSPRFRGLHALRRYPNGEERCIACKLCEAVCPALAITIDSEQREDGTRRTTRYDIDLFKCIYCGFCEESCPVDSIVETRILDYHFEERGEHILHKEQLLALGDKYEAQIAADRAADAPYR

nuoI2

NADH-quinone oxidoreductase subunit I 2

162 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

18.714 kDa

MNINATARSLLLTEFVSAFFLAMRYFFKPKPTINYPFEKNPISPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGLCQEACPVDAIVEGPNFEFATETREELYYDKARLLANGDRWEREIAKSIELDAPYR

nuoI2

NADH-quinone oxidoreductase subunit I 2

162 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

18.571 kDa

MGVTTAARSLLLTEFVSAFFLAMRYFFKPKPTLNYPFEKGPISPRFRGEHALRRYPNGEERCIACKLCEAVCPAQAITIEAGPRRNDGTRRTERYDIDMVKCIYCGLCQEACPVDAIVEGPNFEFATETREELYYDKAKLLANGDRWEREIAKHMALDAPYR

nuoI2

NADH-quinone oxidoreductase subunit I 2

162 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

18.743 kDa

MNINATARSLLLTEFVSAFFLAMRYFFRPKPTINYPFEKNPISPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIEAGPRRNDGTRRTVRYDIDMVKCIYCGLCQEACPVDAIVEGPNFEFATETREELYYDKARLLANGDRWEREIAKSIELDAPYR

nuoI2

NADH-quinone oxidoreductase subunit I 2

151 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

17.438 kDa

MIELLKKIFLVDLFQGLFVTFRNQNPKYIYTEQYPAERPKVAERYRGAPRLNINPDNGETLCISCNLCALACPENLIVVTSERSEVTKRKELVTFTYDTSRCMFCGLCEDACPVDALELTQDFEMASYTREGQIWDRQALEEGPRPTQYKC

nuoI2

NADH-quinone oxidoreductase subunit I 2

131 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 23 kDa subunit family.

15.085 kDa

MIMPLINGLKITLKHMFMKPVTLQYPDERPTPSPNFRGLHALKVSHSKAKCVCCYLCPTVCPAKCITVEAGEDQEHNKYAERYEIDMLRCIFCGYCVEACPVDALKMTGEFELANYKREDFVFVKERLLEK