nuoD2

NADH-quinone oxidoreductase subunit D 2

440 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

48.444 kDa

MSTSHASPRETTEGTVYTVTGGDWDEVVQSAARADDERIVVNMGPQHPSTHGVLRLILEIDGETVTEARCGIGYLHTGIEKNLEYRTWTQGTTFVTRMDYLTPFFNEAAYCLGVEKLLGIDDQIPDRATIIRVLLMELNRLSSHLVAIATGGMELGATTIMIYGFRDRELILDIYELITGLRMNHAYIRPGGLAQDLPPGAVDQIREFVKKMNKNLPEYDKLATGNPIFKARMQDVGYLDLAGCMALGATGPVLRSTGLPHDLRKTQPYCGYETYDFDVPTADTCDSYGRFLIRLEEMRQSLRIVEQCLDRLQPGPVMVADKKIAWPAQLALGPDGLGNSLDHIKKIMGTSMEALIHHFKLVTEGFRVPPAQVYTAVESPKGELGVHVVSDGGTRPFRVHFRDPSFTNLQAMAAMCEGGQVADVIVAVASIDPVMGGVDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

435 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

49.388 kDa

MSHVHQAGEAFASSPAESRQEIRNYTMNFGPQHPAAHGVLRLILEMDGETIMRADPHVGLLHRGTEKLAESKPFNQSIGYMDRLDYVSMMCNEHAYVRSIETLMGIEAPERAQYIRTLFDEITRILNHLMWLGSNALDLGAMAVMLYAFREREELMDCYEAVSGARMHAAYYRPGGVYRDLPDHMPKYKESRWHKGKALKNLNAAREGSLLDFLENFTNEFPGRVDEYETLLTDNRIWKQRTVGIGVVTPELAHQWGMTGVMLRGSGIAWDLRKKRPYAKYDAVDFDIPLGKEGDCYDRYLVRIAEMRESNRIIKQCVAWLKANPGPVMVKNFKVAPPKREDMKDDMEALIHHFKLFSEGYCVPAGETYAAVEAPKGEFGCYLVSDGANKPFRVHLRAPGFAHLSSIDSIVRGHMLADVVAMIGTYDLVFGEVDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

431 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.477 kDa

MNDHKGLGGLDTEATPGSFGAGEPPRALGQAGLAAENELDAPLASKLMTVNLGPSHPAMHGVTRAVVELDGEMIRSMKLDIGFLHRGFEKSCENVTWTQCFPYTDRLNYVSSIMNNVGFALAVEKLCKLDVPERAKYLRVVTSEIHRICDHLTLVGAMAMELGAMTVFLYAIEARDIIYDRLAELCGARLTSNYGRIGGVARDTPDGWIEKTEKTLDRVKGYVDEIDQLVSRNRIFIDRTRGTGVVPRADAIELGFTGPCLRASGEPYDLRKAAPYLVYDRIDFDIPVGTNGDNFDRFQMRMEEMRQSDRIIRQCFAQMEPGEIAVQDFRYVLPPKPLVYGTIEGLMAHFKIIMEGIQVPAGEAYGYTEAANGELGFYVVSDGGGRPYKLGLRAPGWPMLAALPFMSVGSLLSDLIPTFDSINMIGGEVEQ

nuoD2

NADH-quinone oxidoreductase subunit D 2

431 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

47.547 kDa

MSEAKGVGGIDPRATPGSAGAGERPPMGTLSPRAGEGELYAPMPSKHMVINLGPSHPAMHGVTRAVVELNGEIIEGMKLDIGFLHRGFEKSCENVTWGQVFPYTDRLNYVSSIMNNVGFALAVEKLAKLEIPERARYLRVITSEIHRICDHLTLVGAMAMELGAMTVFLYGIEARDLLWDRLAELCGARLTSNYARIGGVARDIPEGWQEKTLKVLDRVVAIREEIGQLLNRNRIFIDRCLNTGKVSREDALELGFTGPCLRASGEPYDVRKAAPYLVYDRLDFDIPVGSNGDNFDRYLMRMEEMRQSDKIIRQCFEQMAPGEIIVQDFRYALPPKPLVYGTIEGVMAHFKLVMEGIKVPAGEVYSYTEAANGELGFYVVSDGGGRPYKLGLRAPGWPMLAALPVMTKGSLLSDLIPTFDSINMIGGEVEQ

nuoD2

NADH-quinone oxidoreductase subunit D 2

417 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.922 kDa

MTVAEIRARNLSIPAPSQITRPALAGEKETMVLNMGPHHPSTHGVLRLVVELDGETVVDVAPDIGFLHTGIEKTMESKTYQKAVVLTDRTDYLAPLSNNLSYVLAVEKLLGCEVPERATVARVLLVELQRIASHLVWLGTHALDLAAMSVFLYGFREREQILDIFELVSGARMMTSYFRVGGLAYDLPAGFDAAVEAFLQIMPGRIDEYEALLTDNPLWIERTQGIGAIDSEAAIALGLTGPGLRATGVAWDLRKTMPYCGYETYSFAIPTATHGDIYDRYLVRMAEMRESVSICRQALQRLRDIGPGPYMTSDRKIAPPPKSEITQSMEALIHHFKLWTEGFKPPRGDALAAVESPRGELATYIVSDGSAKPYRVHFRAPSFVNLQSLPHMARGHLVADLVALIASLDPVLGEVDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

411 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.712 kDa

MTEPITVPTPQQIIEPAVAGRTETMVLNMGPHHPSTHGVLRLVLELDGEVVVNVAPDVGYLHTGIEKTMESKTYQKAVVLTDRMDYLAPLSNNLCYALAVEKLLDVEIPERAQIARVLLTELQRISSHLVWLGTHALDLAAMSVFLYAFREREQILDIFELVSGARMMTSYFRIGGLAYDLPSDFIPTVEQFLAVMPSRIDEYEDLLTANPLWLERTVGVGVIDAQSAIALGLTGANLRATGVAYDVRKAMPYSGYETYSFEIPVGKNGDIYDRYRVRIAEMRQSVKIVQQATERLRELGPGPVVTSNRKVAPPPKREITESMESLIHHFKLWTEGFKPPRGDAYVSIESPRGILGCYVVSDGSPKPWRVHFRAPSFINLQSLAHMAKGRMVADLVALIASLDPVLGEVDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

404 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.831 kDa

MTEVTELSRPEGEALNTREVLLNLGPQHPSTHGVLRLVLELDGEFVERVDPHIGYLHRGTEKLAESFTYTQIFPLTDRLDYLCPPSNNLAFALAVEKLLGIEAPIRAQYIRVMMAELARISGHLLITGALPMDLGAMTALLYVMREREMIMDLLEMITGARMHTSFCRVGGVREDLPDGFFPKIREFCDIFPNRIRDYERLLEDNRVFLNRTKGIGVISAEDAVDLGLSGPNLRASGVDWDIRRDEPYEIYDRLDFNVITRDEGDCYARWRCRVDEMRESMRIIEQCIDQMPEGPFQIDMPTIAFPLDKDRVHCSMEALIQHFDLSAYGFKVPKGEVYSAIEAPKGELGFYIISDGSPKPFRMKVRAPSFVNLQALFGVTNARYLADMIAVLGSLDPVMAEVDK

nuoD2

NADH-quinone oxidoreductase subunit D 2

404 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.702 kDa

MTEVTELMRPEGEALNTKEVLLNLGPQHPSTHGVLRLVLQLDGEYVERVDPHIGYLHRGTEKLAESFTYTQIFPLTDRLDYLCPPSNNLAFALAVEKLLGIEAPIRAQYIRVMMAELARISGHLLITGALPMDLGAMTALLYAMREREMIMDLLEMITGARMHTSYCRVGGVREDLPDGFLPKIREFCEIFPNRIRDYERLIENNRVFLSRTQGVGVISATDAIDLGLSGPNLRASGVDWDIRRDEPYEIYDRLDFDVITREEGDCYSRWLCRVDEMRESIRLIEQCMEQMPEGPFQVDIPTIAFPVDKERVHCSMEALIQHFDLSAYGFDVPAGEVYSVIEAPKGELGFYIISDGSPKPFRMKVRAPSFVNLQALFGVTNARYLADMIAVLGSLDPVMAEVDK

nuoD2

NADH-quinone oxidoreductase subunit D 2

404 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.67 kDa

MTEVTELMRPEGEALNTKEVLLNLGPQHPSTHGVLRLVLQLDGEYVERIDPHIGYLHRGTEKLAESFTYTQIFPLTDRLDYLCPPSNNLAFALAVEKLLGIEAPIRAQYIRVMMAELARISGHLLITGALPMDLGAMTALLYAMREREMIMDLLEMITGARMHTSYCRVGGVREDLPDGFLPKIREFCEIFPNRIRDYERLIENNRVFLSRTQGIGVISAADAVDLGLSGPNLRASGVDWDIRRDEPYEIYDRLDFDVITREEGDCYARWLCRVDEMRESIRLIEQCMEQMPEGPFQVDIPTIAFPVDKERVHCSMEALIQHFDLSAYGFDVPAGEVYSVIEAPKGELGFYIISDGSPKPFRMKVRAPSFVNLQALFGVTNARYLADMIAVLGSLDPVMAEVDK

nuoD2

NADH-quinone oxidoreductase subunit D 2

404 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.713 kDa

MTEVTELSRPEGEALNTREVLLNLGPQHPSTHGVLRLVLELDGEFVERVDPHIGYLHRGTEKLAESFTYTQIFPLTDRLDYLCPPSNNLAFALAVEKLLGIEAPIRAQYIRVMMAELARISGHLLITGALPMDLGAMTALLYVMREREMIMDLLEMITGARMHTSFCRVGGVREDLPDGFFPKIREFCDIFPNRIRDYERLLEDNRVFLNRTKGIGVISAEDAVDLGLSGPNLRASGVDWDIRRDEPYEIYDRLDFNVITRDEGDCYARWRCRVDEMRESIGIIKQCIDQMPEGPFQIDMPTIAFPLDKDRVHCSMEALIQHFDLSAYGFKVPKGEVYSAIEAPKGELGFYIISDGSPKPFRMKVRAPSFVNLQALFGVTNARYLADMIAVLGSLDPVMAEVDK

nuoD2

NADH-quinone oxidoreductase subunit D 2

402 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.209 kDa

MTEALGTETPGMRNFTINFGPQHPAAHGVLRLVLELDGEVVERVDPHIGLLHRGTEKLIEQKTYLQAIPYFDRLDYVAPMNQEHAFCLAAEKLLGIAVPRRGQLIRVLYCEIGRILSHLLNVTTQALDVGALTPPLWGFEEREKLMMFYERASGSRMHAAYFRIGGVHQDLPPKLIDDIDAWCDPFLQVVADLDALLTDSRIFKQRNVDIGVVSLKQAWEWGFSGVMVRGSGAAWDLRKAQPYECYAEMDFDIPIGKNGDCYDRYLIRMEEMRQSARIMKQCIAKLRAADGQGPVAVEDNKIFPPRRAEMKRSMEALIHHFKLYTEGFRVPAGEVYAAVEAPKGEFGVFLVSDGSNKPYKCKIRAPGFAHLQAMDFICRGHLLADVSAILGSLDIVFGEVDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

401 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.377 kDa

MGETEIEKVSDTTFVLQMGPHHPATHGVLKLLCEFEGERVINIKPDVGYLHRGVEKLSESKTYPGAMTLTDRLDYISSMTNNIGYCLAVERLMGIEPPPRAKFIRTMVSEMTRLSSHLLWLATHALDIGAMTVFLYAFREREQILQFFEKICGARLTVSYPRIGGVRVDIKEHVLDEIYKFMDLMLIRVDEYETLLTENRIWIARTRGVGVIAPEDAVLLGLTGPALRGSGVYYDIRKQIPYDAYSEIDFEVPLGEKGDTYDRYLCRIREMRQSVLIVKQCIEKMPEGKILSDKSPDIDLPHQAKRKIEPGDSLWNGFIAFSEEKQEIMPKGEIYSAIEAPKGELGFYIVSDGSGRPYRMRVRAPSFIHISAIPKLCEGHLLADVIAIIGTLDIVMGEADR

nuoD2

NADH-quinone oxidoreductase subunit D 2

401 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.874 kDa

MAHMNPTPVLEAGQDKTMVLNMGPQHPSTHGVLRLLLEIDGETIVRIMPDIGYLHTGIEKTCEAKFYQQVVPMTDRIDYLCPMTNNLAYVLAVEKLLGLEIPERAQWIRVLCNELTRINSHLVWLGTGAMDLGAMTVFLYCFREREELLKLFEAVAGQRMMTSYFRVGGVSLEPPLGWFDRVKKFADTFPSKMDEYEGLLTQNPIFVMRTKGVAKITKEDALALGASGPTLRGSGIDFDLRRDMPYSGYDKFKFNVPVKTEGDVYARYQCRIAELRESCKIVQQALAGMPEGSIKADAPKVVLPDREKMKTQMESLIYHFKIVTEGFTVPPGEVYSAIESPRGEMGYYIVSDGTAKPYRVHMRSPSFANLQMLPSMCTGQLLADVVAAIGSIDIVLGDCDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

399 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.932 kDa

MADDVQLESSVRFTQTGPQTIVLEKDLDTEYMIVNMGPQHPSTHGVLRVELLTDGEVVVKATAHLGYLHRCFEKHAEYVDYPGIVPYVDRMDYLASMNNDFAYCVAVEKLLGIEIPRRIEFMRVIVAELNRIASHLVAIGTYAIDLGAFTPFLFCFRDREHLLNLLEWICGARMLYNYIWVGGVSHDFPAKFEERVMEFVRYFKPQARELYQLLTENEIFVQRTKDIGLLPADVAINAGASGPMLRGSGVKWDLRRDDPYSIYPELEFDVAVPDGKASVIGDCLSRHLVRAIEIDESLKMIEQCIDMMPKDPNFDPHAAVPKRVKPKAGEVYARGEAPRGELGFYIISDGKGTTPFRCKARSSCFVNLSLLPEMAKGQYIADVVAIIGSVDIVLGEVDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

399 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.035 kDa

MIASKESNSAATPATSAPTLRTTAEIAATAAMGHAPHETFTINLGPQHPAAHGVLRVLMRMDGEWVENAEPVIGYIHRMHEKMGENRTWAKFLPNTSRIDYLSAMHYTHAWVGVVERGLKIEVPERAEYIRVITSELNRIASHQVWWGALLLDLGGFTPILYAFDDREKILDLLEGLCGARLTYCYYRFGGLYNDADDDFLKGTREFVKYMRPRLKMYRDLVTDNVILRQRLTGIGPISADTCRKYGATGPVIRGSGVAYDVRRAEPYSVYPKLQFKIPTYPECDSMARYLVRMDEMEESLNIIEQCLDLIQPGPFMAPKVPRVIRLPAGDYTYAVEAARGRFMVRVVSDGKENPYRARLRTPSFGNLSLFEETSRGMLLPDALAMMGSLDLVIPDIDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

396 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

45.3 kDa

MDEAGFRNFTVNFGPQHPAAHGVLRLVLELDGEVVERADPHIGLLHRGTEKLIEYRTYLQALPYFDRLDYVAPMNQEHAFCLAIEKLLQMPVPRRGQLIRVLFCEIGRLLSHLLNITTQALDIGALTPPLWGFEEREKLMVFYERASGARMHANYFRVGGVHQDLPEKLLDDIWNFCEPFLKVCNDLEELLSYNRIFKQRNVDVGVISLDEAWTRGFSGVMVRGSGAAWDLRKAQPYECYDELQFDIPVGKHGDCYDRYLIRMEEMRQSVRIMKQCLEKLSSVDGKGPIIEQNHKVTPPRRSEMKRSMEALIQHFKLYTEGHHVPAGEVYAAVEAPKGEFGVYLISDGSNIPYRCKIRAPSFAHLQAIDFLSHKHMLADVSAIIGSLDIVFGEIDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

394 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

43.554 kDa

MTPAADPGQGILSRMTETTIGIGGAAESTDMVLNIGPQHPSTHGVLRLRIVLDGERVQHAEPVIGYMHRGAEKLFEARDYRQIIMLANRHDWLSAFSNELGVVMAVERMLGMEVPERAVWTRTLLAELNRVLNHLMFLGSYPLELGGITPVFHAFREREELQAVMEEVSGGRMHYMFNRVGGLKEDVPAGWAGRVRDAVASVRSRMDVYENLVLGNEIFRGRTRDVGVLSAAAVHAYGVSGPIARASGVDFDLRRDEPYLAYGELRDTLKVVTRTEGDCLARFECLLEQTLNSLDLADACLDRMAHLAPGPINQRLPKVLKAPEGHTYAWTENPLGVNGYYLVSKGEKTPYRLKLRSASFNNIQALTELLPGTLVADMVAILGSLFFVVGDIDK

nuoD2

NADH-quinone oxidoreductase subunit D 2

393 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

44.839 kDa

MDNDHLTTLNLGPTHPATHGVFQNILKMDGERIVDAVPTVGYIHRAFEKIAERRAFYQITTLTDRMNYCSAPLNNMGWHMTVEKLAGIELPKRVEYMRVVIMELSRIADHLICNSILGVDAGAFTGFLYIMQSREQIYEIFEEICGARLTTNMGRIGGFERDFNDIAMRKIDKFLADYPAVLTEFENLFNRNRIFMDRTIGTGGITAERALNYGFTGPNLRAAGVDYDVRVTSPYSSYQDFDFTIPIGINGDTYDRFMVRNKEMWESLSIIRQAMEKIKALPKGVFHAEVPDFYLPPKEDVYSQMEALIYHFKIVMGETEIPKGEVYHSIEGANGELGYYLVSDGGRTPYRLHFRRPCFIYYQAYPEMIKGQLISDAVVTMSSLNLIAGEMDA

nuoD2

NADH-quinone oxidoreductase subunit D 2

388 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

42.776 kDa

MTGMTTDADLRELTVGTGAGGEQLGTDMVLNIGPQHPSTHGVLRLRLVLDGERVVSAEPVVGYMHRGAEKLFEVRDYRQIIVLANRHDWLSAFANELGVVLAVERLLGMEVPERATWLRMALAELNRVLNHLMFLGSYPLEIGAITPMFYAFRERETLQTALEEVSGGRIHYMFNRVGGLKEEVPAGWTGRARAAIGEVRRSLPDLDNLIRRNEIFLARTVGVGVLSAAQAAAYGASGPVARASGLDLDLRRDEPYLAYDQLDVPVVTRTAGDCHSRFEVLLDQVYVSLDLAEQCLDRVDRLTGPINTRLPKVLKAPEGHTYAWTENPLGINGYYLVSRGEKTPWRLKLRTASYANVQALATLLPGCLVPDLVAILGSMFFVVGDIDK

nuoD2

NADH-quinone oxidoreductase subunit D 2

388 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

43.669 kDa

MSQVIFSVDRGGAEPGAEMDDEMTLNMGPHHPSTHGVLRFVISTDGEIIRKAVPDVGYLHRSIEKIGERCTYSGFMPYTDRVDYIAAMFANEAWASACEKLMGIEVPKRAQYLRVISCELNRIGSHMIALGAMAMDVGAVTPFPWALREREYINDFIEELCGARLTFNYHRIGGVSFDMPKGWADKVKHWLDRFEPIMVEFDRLISLNDIFIKRLANVAVVTAEEAKDWGLVGPNLRGSGVKWDLRKEDAYSVYPELEFDVPVGRGRYGTVGDCWDRFYVRVEECRESAKILRQALDKIDEHPEDDILGKLPKKMRPDGEAYARIESARGDMGCYVIGRGAEEAYRARFRTGSFTAMAMIEAKSPGLFLADLVALIASFDVVAPEIDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

385 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

42.66 kDa

MTTDAELRELTVGTGAGGEQLGTDMVLNIGPQHPSTHGVLRLRLVLDGERVVSAEPIVGYMHRGAEKLFEVRDYRQIIVLANRHDWLSAFANELGVVLAVERLMGMEVPERATWLRMALAELNRVLNHLMFLGSYPLEIGAITPMFYAFRERETLQAVLEEVSGGRIHYMFNRVGGLKEEVPAGWTGRARTAIGEVRRRMPDLDRLIRRNEIFLARTVGVGVLSAAQAAAFGASGPVARASGLDLDLRRDEPYLAYDQLEVPVVTRTAGDCHSRFEVLLDQVYVSLDLAEQCLDQVDRLTGPVNTRLPKVLKAPEGHTYAWTENPLGINGYYLVSRGEKTPWRLKLRTASYANVQALATLLPGCLVPDLIAILGSMFFVVGDIDK

nuoD2

NADH-quinone oxidoreductase subunit D 2

384 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

43.902 kDa

MNVERTQELLVNMGPQHPSTHGVLRLMIKLDGEQVTWCEPDIGYLHRCFEKLAEQKTYPQVIPFTDRTDYLAAMLNELCYVEAVEKLFGDAIQVPERAQYIRVMLAELQRITSHLLALGSMAMDLGATTPFLYCWRDREKLYSLFERITGGRMLYNYLRIGGVRNDLPEGILGTPQDGEDKADKTIWGFINYFDSYVYPEWKALVTGNRIFQYRTKNIGVLTAEQAIAYSCSGAVLRGSGVKWDLRKNLPYAIYDRFEFDIPVGQNGDSFDRWWVRQEEMYQSSRIVKQCLEWLAENPGPVMAPKMPRVLKPPKGEVYHRIEGARGEVACYVVSDGSTNPYKVKWRSPAFTHLQLMPLLCPGHKIADIIAILGSIDVVLGEVDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

383 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

42.567 kDa

MTPTTETMVGIGGAAESTDMVLNIGPQHPSTHGVLRLRLVLDGERIQHAEPVIGYMHRGAEKLFEARDYRQIIMLANRHDWLSAFSNELGVVLAVERMLGMEVPERAVWTRTLLAELNRVLNHLMFLGSYPLELGGITPIFYAFTEREELQHVMEEISGGRMHYMFNRVGGLKEDLPAGWATRARACVAALRSRLDVYDDLVLGNEIFRGRTRGVGVLTPEAVHAYGVSGPIARGSGVDFDLRRDEPYLAYGELQDTLKVVTRQEGDCLARFECLLEQTHNALDLADACLDRLAELPPGPINQRLPKVLKAPEGHTYAWTENPLGINGYYLVSKGEKTPYRLKLRSASFNNIQALTELLPGTLVADMVAILGSLFFVVGDIDK

nuoD2

NADH-quinone oxidoreductase subunit D 2

379 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

42.443 kDa

MEKLILRRVDRQNEEMILNFGPQHPSTHGVINFLVETDGEVLKRATPDVGYLHRSIEKIGELVGYPGFMPYTDRVDYVAAMFANEGYAIAVERLLKIEVPQRAQWLRAISCELCRIASHLVSVGTMVMDIGAFTPMLHGIRERETINDLLEALCGARLTYNYHRIGGVAFDLPEGWRDKVLHFLDHFDKFLAEFDRLISFNEIYVKRLANVAVIPGPMAINYGLVGPNLRGSGVDWDVRRDLPYGAYPNFKFDVPVGKGFFGTAGDSFDRYYVRCLEMAESSKIVRQALDSLPEGEITAKVPRNIKPEAGEALGRVESARGELAYYVISDGTNKAYRVRARTGSFTAMCIIEDISRGLMVADLVALISSLDVVAPEIDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

374 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

42.313 kDa

MLQTQELQINIGPQHPSTHGVFRMIVTVDGETIIDLKPVFGYLHRNHEQLAEVSTYIQSMPYTDRLDYFNSMANNHALALAVEKLAGISVPQRAEYIRVLMVELTRILNHASAVGFLLNDMGAWQTPLMFGMREREKILDLFEMASGARMMCNYFRFGGVWRDLPPEFIPQLKELMQGLPSFFDEFERLLRENEILLSRTVNVGILPKEVAVSYSVTGPVLRASGIPYDVRRAEPYSVYGDLDFDIPIGSVGDVYDRFLIRIEEMRQSYRILQQVIERLPDTTGGHINPAMANIGKQKALRPPPGDAYARIESPKGELGFYLVSDGSERPYRYKVRAPSFINLTPLGDMCRGHKVADVVVILGSIDIVMGEVDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

370 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

41.613 kDa

MPDSTFLDSTELVLNMGPQHPSTHGVLRVILKLDGEKVLGTDCIIGYLHRGVEKIAENRTYAQFNPYVDRMDYVAAVSNGLGYCLAIEKLLNVEAPPRAQCIRVILTELNRIASHLLWLGTHALDIGAITPVFYCLREREEALKIFEKYCGARLTTHAFRIGGLLYETYDGFEQEIRDFCKMFIPKVDEYEELLTNNRIWVGRLKDVGILSADECKEFGVTGPVLRAAGVKWDLRKAQPYSGYEKYDFEIPTRVNGDTYDRYIVRMEEMRQSVRIMQQAVDGIPEGPIMGKVGKVIKPPIGEAYVSIEAPKGELGYYAVSDGSTQPYRIRVRPPSFVNLQALDRMIRGGLIADVVAVIGTLDIVLGEIDR

nuoD2

NADH-quinone oxidoreductase subunit D 2

370 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 49 kDa subunit family.

41.671 kDa

MLKTEELQINIGPQHPSTHGVFRMLVTVDGETLVDLKPVFGYLHRNHEQLGEVNTYLQNMPFTDRLDYFNSMVNNHAYARAVETLAGVEVPERAQYIRVIMDELSRILNHATAMGFMLGDMGAWQTALLWGMREREKILDMFEYVSGARMMCNYCRFGGVVRDIDDWFITELKKLMQGLPHYFDDFEGLLLNSEILLARARNIGVLPKELALAYSVTGPVLRGSGVAYDIRKAEPYAVYDRFKFKVPVGTVGDVYDRFLVRIAEMRESYKILEQAIEQLPDATGGFINPKVKQQSLKAPAGEAYARVESPKGELGFYLVSDGSGSAYRYKVRAPSFINLSSLADMCKGYSIADVVVILGSIDIVMGEVDR