nuoB2

NADH-quinone oxidoreductase subunit B 2

268 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

30.126 kDa

MSDDRDIQLEAEKQGVFLTTMQRFYNWGRRSSVWPLSFGLACCAIEMMATGLARFDLARFGAEMFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMPEPRYVISMGACATSGGPFRDGYNVLRGIDLLIPVDVYIPGCPPRPEALLHALMTLQKQIDAQRLNRVRWYGKREAKEYPVPAFGKHGLEIDGKLVDPVGGLPLISPYTSPTHGEMRSGEIEHPELVRHFPIMDETVELESPNKAKGVAPEIRHNDLKRPAVEVDHARDEQR

nuoB2

NADH-quinone oxidoreductase subunit B 2

264 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

29.204 kDa

MADIDPNQLELERQGILLTTVNRFYNWGRRSSIWPMAFGLACCAIEMMAFGLSRYDVARFGAELFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMAEPRYVISMGACATSGGPFRDGYNVLRGIDLLIPVDVYVPGCPPRPEALLHALMTLQEQIDRQKLGRVRWYGEGDKPQTTDFPVPTFGAKGLEIDGKLIDPVGGLPLLSPYTSPSHGEHRSGQIEHPEVVRQFPIMDPEVELEHALKARGVSPEIAADDLKRGEVSNA

nuoB2

NADH-quinone oxidoreductase subunit B 2

250 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

27.009 kDa

MSDLQTQMDLEQQGVLFTTINKLYNWGRRSSVWPMQFGLACCAIEMIAAAASRYDISRFGSELFRASPRQADVMIVAGTVTKKMVPQVVRLFNQMPEPRYVISMGACATSGGPFRDGYNVVRGVDLYVPVDVYIPGCPPRPEALLHALMTLQAQIDVQSLQQVRWYGDDEGVVNEFPVPIFGAEGLEVPGIPGTADPVGGTPKMPPFVSPALGGKGERDASIKALEGNQPKPMLRAGTVTIEEVAHGIAG

nuoB2

NADH-quinone oxidoreductase subunit B 2

235 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

24.989 kDa

MGLTSRPTPASRQPASPPPADPVLLPEPKRLGVLSRLAPEPMKVVLNWGRRYSLWVFNFGLACCAIEFIAASMARHDFIRLGVIPFAPGPRQADLMIVSGTVTDKMAPAVKRLYEQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPEALLQGILKLQEKIARESLAERYATGATGGGPSTDALRSGLVAAPTAPGPTAPASTAPGPTAPAPTQDEERR

nuoB2

NADH-quinone oxidoreductase subunit B 2

232 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

24.854 kDa

MNPGEPADPAPVPLPEPKRLGTLARLAPEPMKVVLNWGRRYSLWVFNFGLACCAIEFIAASMARHDFIRLGVIPFAPGPRQADLMVVSGTVTDKMAPAVKRLYEQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPEALLQGILKLQEKIARESLGERYGVSPRPSTAALQSGLVRPPEPEPEPEPEPEPEPGQGPGQGPGSGEGTDTGSDAGRGR

nuoB2

NADH-quinone oxidoreductase subunit B 2

231 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

25.04 kDa

MRFTFGKGATGQQLSTTAPLLRGLGTAGQPAAPSPGGGTFTDAVRRNVALGRLEDMVAWGRKYSIWPFNFGLSCCYVEMATAFTSKFDIARFGSEVLRATPREADLIVISGTVFVKMAPVIKYLYDQMLEPRWVISMGACANSGGMYDIYAVVQGADSFLPVDVYVPGCPPRPDALLEGLMLLQNSIGSERRPLSWLVGPNGAEKIERPSFRDLKHQERQAAGSLPTPDSV

nuoB2

NADH-quinone oxidoreductase subunit B 2

226 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

25.331 kDa

MGIEEKLPAGVLLTSVEKLVNWSRKSSVWGATFGLACCAIEMMAAGGPHYDMGRWGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPRWVLSMGVCASSGGMFNNYAIVQGVDHVVPVDMYLPGCPPRPEMLIDAVLKLREKIMHEPLGPNGRKMLEARKARGDVPVVPYGSMPSSYRSDKARRAEWTKAVREGREEQLRIENWMKAQPHLQQYEGLKK

nuoB2

NADH-quinone oxidoreductase subunit B 2

226 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

25.337 kDa

MGIEEKLPAGVLLTSVEKFVNWSRKSSVWGATFGLACCAIEMMAAGGPHYDMGRWGMEVFRASPRQADLMIVAGRVSQKMAPVLRQIYDQMAEPRWVLSMGVCASSGGMFNNYAIVQGVDHVVPVDMYLPGCPPRPEMLIDAILKLREKIMHEPLGPNGRKMAEARKARGDVPVVPYGSMPSSYRSDKARRAEWTKAVREGREEQLRIENWMKAQPHLQQYEGLKK

nuoB2

NADH-quinone oxidoreductase subunit B 2

208 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

23.238 kDa

MTMTPQHPGMPDEQRSVEEHMALSSLFTTLEDLTAWSRKHSLWPFNFGLSCCYVEQVTVLTPVYDQARFGAEVIRASPRQADLLVVSGTVFHKMAAPLLRLYEQMRAPRWVIAMGACACSGGMYDIYSVVQGVDRFIPVDVYIPGCPPRPEAVLDALIMLQQQVGSERRPLGVTVGNTAGLGFDAPRRRDQRRDERMAQTLLDPPESL

nuoB2

NADH-quinone oxidoreductase subunit B 2

208 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

23.238 kDa

MTMTPQHPGMPDEQRSVEEHMALSSLFTTLEDLTAWSRKHSLWPFNFGLSCCYVEQVTVLTPVYDQARFGAEVIRASPRQADLLVVSGTVFHKMAAPLLRLYEQMRAPRWVIAMGACACSGGMYDIYSVVQGVDRFIPVDVYIPGCPPRPEAVLDALIMLQQQVGSERRPLGVTVGNTAGLGFDAPRRRDQRRDERMAQTLLDPPESL

nuoB2

NADH-quinone oxidoreductase subunit B 2

205 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

22.876 kDa

MSYTLQRPGEDISVEEHMARTSLFARLEDLVAWSRKNSLWPFNFGLSCCYVEQVTALTSVYDQARFGAEVIRASPRQADLLVVSGTVFHKMAAPLLRLYEQMRAPRWVISMGACANSGGMYDIYSVVQGVDSFLPVDVYIPGCPPRPEAVLDALIMLQQQVGSEHRPLGVTVGNSAGLGFDAPRRRDQRRDERMAQTLLDPPEKL

nuoB2

NADH-quinone oxidoreductase subunit B 2

205 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

22.923 kDa

MSWTIGRPDAEAPEDRMAASHLFTRLDDLVAWSRKHSLWPFNFGLSCCYVEMATALTPVYDQARFGAEVIRSTPRQADLLIVSGTVFRKMAVPLYRLYSQMREPRWVISMGACANSGGMYDIYSVVQGVDSFLPVDVYVPGCPPRPEALMEALVLLQSKIATEARPLQIRMGETGPARPFDPIPRRDALREARMAVTRLADPEAT

nuoB2

NADH-quinone oxidoreductase subunit B 2

205 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

22.908 kDa

MSWTIGRPDAEAPEDRMAASHLFTRLDDLVAWSRKHSLWPFNFGLSCCYVEMATALTPVYDQARFGAEVIRSTPRQADLLIVSGTVFRKMAVPLYRLYSQMREPRWVISMGACANSGGMYDIYSVVQGVDSFLPVDVYVPGCPPRPEALMEALVLLQSKIATEARPLQIRMGETGPARPFDPVPRRDALREARMAVTRLADPEAT

nuoB2

NADH-quinone oxidoreductase subunit B 2

205 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

22.908 kDa

MSWTIGRPDAEAPEDRMAASHLFTRLDDLVAWSRKHSLWPFNFGLSCCYVEMATALTPVYDQARFGAEVIRSTPRQADLLIVSGTVFRKMAVPLYRLYSQMREPRWVISMGACANSGGMYDIYSVVQGVDSFLPVDVYVPGCPPRPEALMEALVLLQSKIATEARPLQIRMGETGPARPFDPVPRRDALREARMAVTRLADPEAT

nuoB2

NADH-quinone oxidoreductase subunit B 2

203 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

21.896 kDa

MDVTPEPVLLPEPKRLGALARLAPEPMKVVLNWGRRYSLWVFNFGLACCAIEFIAASMARHDFIRLGVIPFAPGPRQADLMVVSGTVTDKMAPAVKRLYEQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPEALLQGILKLQEKIARESLSERYGSPRPSAAALQSDLVRPPAAGTGAGTAEGGAR

nuoB2

NADH-quinone oxidoreductase subunit B 2

202 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

22.509 kDa

MSWIENKFEKNFLLSSVDYVFNWARKSSVWPMTFGLACCAIEMITASTARYDIARFGSEVFRPSPRQSDLMIVAGTVTLKMAPVVQRIYEQMPEPKWVMAMGACASVGGPFNTYATLQGVDKIVPVDVYVVGCPPRPENLFYGLLKLQDKIDHMTLAKRPTDVRLDETMLDEFRKSVRIAQAGSTVVIQPAAPPVVPGLQTK

nuoB2

NADH-quinone oxidoreductase subunit B 2

200 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

21.811 kDa

MGLSPGSAKLGSPAQPLIAPAATGILDPRTGRPVGADDRFFVEVNNELSDKGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQMSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYAVVRGCDRIVPIDIYVPGCPPTAEALLYGVMLLQKKIRRIGTIER

nuoB2

NADH-quinone oxidoreductase subunit B 2

199 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

21.855 kDa

MQQQASAMRPEGAQPLIARAPSGIIDPNTGKPVGADDPFFLGVNRELSDKGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQLSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPIDIYVPGCPPTAEALLYGVMLLQKKIRRTGTIER

nuoB2

NADH-quinone oxidoreductase subunit B 2

195 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

21.626 kDa

MGLLDQKFDKGGVVITAAENVLNWARLSSLWPMGFGLACCAIEMMATNASNYDLERFGIFPRSSPRQSDLMIVAGTVTFKMAERVVRLYEQMPEPRYVLSMGSCSNCGGPYWEHGYHVVKGVDRIIPVDVYVPGCPPRPEALIGGLMKVQELIREEKFAGDRREAIERLKPKKVKAEDVIVETSASAKKLQEAAS

nuoB2

NADH-quinone oxidoreductase subunit B 2

191 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

20.612 kDa

MESPLTPSAQPAPMPSLVAATGPSTPEIPPEVSQIARFAKLDDLLALGRANSLWPLTFGLACCAIEMMAAGMARFDISRFGAEVFRPSPRQADVMIVAGTVNKKMAPAVKLLYDQMLEPKWVIAMGQCAISGGPFKYPGQYAVVEGVDQLFPVDVYVPGCPPRPEALIEGILKLEEKITGKRRFPVAQLKE

nuoB2

NADH-quinone oxidoreductase subunit B 2

191 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

20.904 kDa

MSAANATGEGQDAIAWNREMLPPGPEQDAVIKGITGEITEKGFVVASLDKLVNWGRTGSLWPMSFGLACCAVEMIHAYMPRYDLDRMGIIPRGSPRQSDVMIVAGTLTNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALIYGIFQLQKKIRRTGTILRG

nuoB2

NADH-quinone oxidoreductase subunit B 2

186 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

20.727 kDa

MPSFTQPHSAPRNFQFPGQQRQGDPTMGTINAELADKGFLVTSTDELITWARTGSLMWMTFGLACCAIEMMQMSMPRYDIERFGVAPRASPRQSDLMIVAGTLCNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGILLLQRKIRRNGSIER

nuoB2

NADH-quinone oxidoreductase subunit B 2

184 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

20.077 kDa

MEKPMASSGPAELFTRVDDYSVANAAAAANEGIVMTTLDAAVNWARKNSIWPMTFGLACCAIEMMSMSASRFDIARFGAEVFRGSPRQSDLMIIAGRVSNKMAPVIRHLYQQMPEPKWAISMGACATSTGVFNNYALIPVNQVIPIDVFVPGCPPRPEQLIYALMMLQEKIKNQSGTVKSVLNL

nuoB2

NADH-quinone oxidoreductase subunit B 2

183 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

20.374 kDa

MASELDNLPVITTRREEAQGFLQGLVSKGLGWARKYSLFQYPFVTACCGMEFMTVASARYDLDRFGAALPRFSPRQADLLIVVGTVNCKQAPILRRVYEQIAEPKWVVAFGVCASSGGFYDNYATVQGIDRIVPVDVYIPGCPPRPEQVLDGIMLLQQKIQGQQHKLIDRKPLPVVGQEPISR

nuoB2

NADH-quinone oxidoreductase subunit B 2

182 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

19.905 kDa

MTSNLNLMAPPRGWEAKYESDGGGVITTSVDQTVNWLLNWGRSNSVWYMLFGLACCAIELMQTGGPRGDLERFGAAPRPSPRSSDLFIIAGTLTYKMATRVKRLYDQMSEPRFVISMGSCSNCGGLFQYAYSVCKGVDQIIPVDVYVPGCPPRPEALLEGLLKIQEKIKSERALGRRGATGG

nuoB2

NADH-quinone oxidoreductase subunit B 2

182 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

19.911 kDa

MSQARHELDWLNDEVVVSEIDVVNENVIAGKLPDVIKKVLGWGYGNSTWPLGFGIACCAIEMMAACSSKYDIARFGSEAMRMSPRQADVMIVAGTVNEKMAVVVRRLYDQMSEPKFVIAMGACASNGGPYWDTYNVVDGVHKVVPVDVYVPGCPPRPEALLQGLMEIQEMIKTGKRGLITKG

nuoB2

NADH-quinone oxidoreductase subunit B 2

182 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

20.09 kDa

MASELDGLPVIATRREEAEGFLQGLVSKSLGWARKYSLFTYPFVTACCGMEYMTMASARYDSDRFGAAMPRFSPRQADLLMVVGTVNCKQAPILQRVYEQMADPKWVMAFGVCASSGGFYDNYATVQGIDRVIPVDVYVPGCPPRPEQVLDGIMLLQKKIQNQSHKLIDRKPLPVISGGAGR

nuoB2

NADH-quinone oxidoreductase subunit B 2

181 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

19.904 kDa

MSDIKIEEKPDGLEGPGFFATSLDSVIGLARKNSLWPLPFATSCCGIEFMATMASTYDIARFGAERPSFSPRQADVLLVMGTIAKKMGPVLRHVYEQMAEPKWVVAVGACASSGGIFDTYSVLQGIDRIIPVDVYVPGCPPRPEQIIQGLMRVQDLASTESLRRRESPEYKALLAKYEIEE

nuoB2

NADH-quinone oxidoreductase subunit B 2

174 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

19.429 kDa

MTGLNTAGHDRDYDTAGLNRELQDKGFLLTTTEDLINWARTGSLHWMTFGLACCAVEMMHTSMPRYDVERFGVAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRRIRRTGTITR

nuoB2

NADH-quinone oxidoreductase subunit B 2

174 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

19.216 kDa

MLPSTNDKQLIEVEEGTKIIKGSNVIITTLDKVVNWGRSNSLWPLTFGLACCAIEMMAAGASHLDLDRFGILFRASPRQADVIIIAGTVTYKMAPIVKRVYDQMPEPKYVIAMGSCACTGGIFNTYSTVQGADQFLPVDVYVPGCPPRPEALMYGVLKLKEKIMREEGRWGRLK

nuoB2

NADH-quinone oxidoreductase subunit B 2

174 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

19.139 kDa

MGIEEKAGNLGIVTTTLETVVNWGRTNAMWPLLFGLACCAIEMMGAQASNYDLSRFGMELNRASPRQADLMIVAGRVSRKMAPVVRRLYDQMPEPKWVIAMGDCAACGGIFNNYAIVQGVDEVVPVDVYVAGCPPRPEALIDGIMMLHQKVMREKISGKKESPIRIDQPLVQVK

nuoB2

NADH-quinone oxidoreductase subunit B 2

174 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

19.139 kDa

MGIEEKAGNLGIVTTTLETVVNWGRTNAMWPLLFGLACCAIEMMGAQASNYDLSRFGMELNRASPRQADLMIVAGRVSRKMAPVVRRLYDQMPEPKWVIAMGDCAACGGIFNNYAIVQGVDEVVPVDVYVAGCPPRPEALIDGIMMLHQKVMREKISGKKESPIRIDQPLVQVK

nuoB2

NADH-quinone oxidoreductase subunit B 2

173 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

18.786 kDa

MAARMDPGIGGEVTLLHTSQLDNLINLARASSLYYLTFGLACCGIELMQTGGPRADLMRFGAIPRASPRQADFMIVAGTLTYKMAERARLLYDQMPEPKYVISMGSCSNCGGLFQLGYSVCKGVDKVIPVDVYVPGCPPRPEALTEGLLRLQEIVRSEPWSTKRRPAAQAEGA

nuoB2

NADH-quinone oxidoreductase subunit B 2

171 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

19 kDa

MDSPSLEKDGFLLTTLDGLFGRAQSGSLWYLSFGLACCAVEMMHAAAARYDMDRFGWIPRATPRQADLMIVAGTLTNKMAPAMRKVYDQMSEPRYVLSMGSCANGGGYYHYSYAVVRGCDRIVPVDVYVPGCPPTAEALLYGLMQLQAKIRRDDTASRRELLDRSPNRQPN

nuoB2

NADH-quinone oxidoreductase subunit B 2

167 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

18.29 kDa

MGTVNNAIRDSVLFTTADSIINWSRSSALWPETFGIACCAIEMISAGCARYDLDRFGVVFRPSPRQSDVMIIAGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYNTYAVVQGSETFVPVDVHVPGCPPRPEALMHGFLLLQEKIKRSRALAGTPLDRVIAS

nuoB2

NADH-quinone oxidoreductase subunit B 2

167 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

18.247 kDa

MAGVNDAIRDSVLFTTADSIISWSRRSALWPETFGIACCAIEMISAGCARYDLDRFGVVFRPSPRQSDVMIIAGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYNTYAVVQGSETFVPVDVHVPGCPPRPEALMHGFLLLQEKIKKSRALTGTPLGRVIAS

nuoB2

NADH-quinone oxidoreductase subunit B 2

167 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

18.336 kDa

MGIEQKAGDMGIVTASLEQLVNWSRSSAMWPLLFGLACCAIEMMGAQGANYDLSRFGMEINRASPRQADLMIVAGRVSRKMAPVVRRLYDQMADPKWVIAMGDCAACGGVFNNYAIVQGVDEIVPVDVYVAGCPPRPEALIDGIIHLHEKVKRMRLDGELREPVRLS

nuoB2

NADH-quinone oxidoreductase subunit B 2

167 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

18.469 kDa

MANHPLTLEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQCDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGLMQLQRKVAERSTHSRPKLFARP

nuoB2

NADH-quinone oxidoreductase subunit B 2

167 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

18.469 kDa

MANHPLTLEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQCDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGLMQLQRKVAERSTHSRPKLFARP

nuoB2

NADH-quinone oxidoreductase subunit B 2

167 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

18.469 kDa

MANHPLTLEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQCDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGLMQLQRKVAERSTHSRPKLFARP

nuoB2

NADH-quinone oxidoreductase subunit B 2

167 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

18.469 kDa

MANHPLTLEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQCDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGLMQLQRKVAERSTHSRPKLFARP

nuoB2

NADH-quinone oxidoreductase subunit B 2

167 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

18.469 kDa

MANHPLTLEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQCDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGLMQLQRKVAERSTHSRPKLFARP

nuoB2

Putative NADH-quinone oxidoreductase subunit B 2

167 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

18.55 kDa

MANHPLTLEKDGFIVTTLDAAMAAAQKNSLWYMTFGLARCAVEMMHAAGARYDMDRFGMIPRASPRQCDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYGYSVVRGCDRIVPVDVYVPGCPPTAEALVYDLMQLQRKVAERSTHSRPKLFARP

nuoB2

NADH-quinone oxidoreductase subunit B 2

167 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

18.469 kDa

MANHPLTLEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQCDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGLMQLQRKVAERSTHSRPKLFARP

nuoB2

NADH-quinone oxidoreductase subunit B 2

167 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

18.469 kDa

MANHPLTLEKDGFIVTTLDAAMAAAQKNSLWYMTFGLACCAVEMMHAAGARYDMDRFGMIPRASPRQCDLMIVAGTLTNKMAPAMRRVYDQMAEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGLMQLQRKVAERSTHSRPKLFARP

nuoB2

NADH-quinone oxidoreductase subunit B 2

159 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.621 kDa

MQTPTLHGDGFLLTRLDTLCDMVRSNSMWYLTFGLACCAVEMMQAAASRYDMDRFGMIPRASPRQADLIIVAGTLTNKMAPAIRKIYDQMAEPRYVISMGSCANGGGYYHYSYSVARGCDRILPVDIYIPGCPPTAEALLYGLIQLQNKLKRPPAVIAR

nuoB2

NADH-quinone oxidoreductase subunit B 2

158 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.429 kDa

MSTNGVMEKGFVTTSLDSVINWGRTGSMWPMTFGLACCAVEMMQAGASRYDLDRFGIVFRPSPRQSDVMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGIIQLQNKIHRTNTIAR

nuoB2

NADH-quinone oxidoreductase subunit B 2

158 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.503 kDa

MGIEGVLERGVVTTTADKLINWARTGSLWPMTFGLACCAVEMMHAGASRYDMDRFGVIFRPSPRQSDVMIVAGTLVNKMAPALRKVYDQMSEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGIIQLQNKIKRNYTIAR

nuoB2

NADH-quinone oxidoreductase subunit B 2

158 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.436 kDa

MGIEGLLEKGFVTTTIDTVVNWGRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGIVFRPSPRQSDVMIVAGTLVNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSIVRGCDRIVPVDIYVPGCPPTAEALLFGLVQLQKKIRRTNTIAR