nuoB1

NADH-quinone oxidoreductase subunit B 1

268 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

30.178 kDa

MSDDREIQLEAEKHGVFLTTMQRFYNWGRRSSIWPLSFGLACCAIEMMATGLARFDLARFGAEMFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMPEPRYVISMGACATSGGPFRDGYNVLRGIDLLIPVDVYIPGCPPRPEALLHALMTLQKQIDAQRLNQVRWYGKREAKEYPVPTFGKHGLEIDGKLIDPVGGLPLVSPYTSPTHGEMRSGMIEHPELVRHFPIMDETVERESPYKATGIAIEIAHNDLKRPAVEVDHAEDERR

nuoB1

NADH-quinone oxidoreductase subunit B 1

264 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

29.108 kDa

MAEIDPTQLELERQGILLTTVNRFYNWGRRSSIWPMAFGLACCAIEMMAFGLSRYDVARFGAELFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMAEPRYVISMGACATSGGPFRDGYNVLRGIDLLIPVDVYVPGCPPRPEALLHALMTLQEQIDRQKLGRVRWYGSGDKPQTGDFPVPTFGAKGLEIDGKLVDPVGGLPLLSPYTSPSHGEHRSGQIEHPEVVRQFPIMDPEVELENALKARGIAPEIAADDLKRSVVNDA

nuoB1

NADH-quinone oxidoreductase subunit B 1

264 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

29.108 kDa

MAEIDPTQLELERQGILLTTVNRFYNWGRRSSIWPMAFGLACCAIEMMAFGLSRYDVARFGAELFRASPRQADLMIVAGTVTKKMAPQVVRLYNQMAEPRYVISMGACATSGGPFRDGYNVLRGIDLLIPVDVYVPGCPPRPEALLHALMTLQEQIDRQKLGRVRWYGSGDKPQTGDFPVPTFGAKGLEIDGKLVDPVGGLPLLSPYTSPSHGEHRSGQIEHPEVVRQFPIMDPEVELENALKARGIAPEIAADDLKRSVVNDA

nuoB1

NADH-quinone oxidoreductase subunit B 1

221 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

24.683 kDa

MRWSLSKPSDKPSGPATPGSSIIRDNGFEEDGRRSVLLTRLQDLVAWGRKNSVWPYNFGLSCCYVEMATSFTSKYDLARFGSEVIRASPRQADLIVISGTVFIKMAPVLQRLYDQMLEPRWVISMGSCANSGGMYDIYSVVQGVDRFLPVDVYVPGCPPRPDAFMQGLNLLQDAIGKEKRPLSWVIGPQGIERPAEESQRDLKRSGRMCATTLRSPDEVQK

nuoB1

NADH-quinone oxidoreductase subunit B 1

213 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

23.875 kDa

MSNYAPADPRASSNRYRYNGTCMTNPSERFDNLVGSDQSFEQLRRATFGEQPEEGIVLTTLDNAVNWIRKNSIWPMTFGLACCAIEMMSMGASRFDIARFGAEVFRPSPRQSDLMIIAGRVSQKMAPVIRHLYLQMPEPKWVISMGACATSGGVFNNYALVQGVNQYIPVDIYVPGCPPRPEQLIYAITLLQEKIQAERGSFRRALNLEPVTP

nuoB1

NADH-quinone oxidoreductase subunit B 1

212 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

23.984 kDa

MRWRLSKPQAATSIEQSKGSFEDAIRRNLLFAQLQDLVAWGRKNSLWPYNFGLSCCYVEMVTSFTSKYDIARFGAEVIRATPREADLMVISGTVFIKMAPVIKRLYEQMMEPRWVISMGSCANSGGMYDIYSVVQGVDKFLPVDVYVPGCPPRPDAFLEGLLLLQEAIGKEQRPLSWAIGPQGVERAPKPSLRDQRRAERQKATVFRSPDEV

nuoB1

NADH-quinone oxidoreductase subunit B 1

211 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

23.63 kDa

MRWSLTRPGEEPGTPRDATMTETVKRNLVMGRLQDFVSWGQKNSIWPFNFGLSCCYVEMATAFTSKYDIARFGSEVLRATPREADLIVISGTVFVKMAPIVKYLYDQMLEPRWVISMGSCANSGGMYDIYSVVQGVDSFLPVDVYVPGCPPRPDALLEGLMLLQDSVGTQRRPLSWMVGPQGVERVTPPSLRDAKRDQRRAAQTLRSPDTI

nuoB1

NADH-quinone oxidoreductase subunit B 1

208 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

23.205 kDa

MTLPPAIPPTPADSMSVEEHMARSNLFTTLEDLTAWSRKHSLWPFNFGLSCCYVEQVTVLTPVYDQARFGAEVIRASPRQADLLVVSGTVFHKMAAPLLRLYEQMRAPRWVISMGACANSGGMYDIYSVVQGVDRFIPVDVYIPGCPPRPEAMLDALIMLQQQIGSERRPLGVTVGNTAGLGFDAPRRRDQRRDERMAQTLLDPPEKL

nuoB1

NADH-quinone oxidoreductase subunit B 1

205 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

22.943 kDa

MSYELQRPGEEMPIEEQMARTSLFTRLEDLVAWSRKNSLWPFNFGLSCCYVEQVTALTPVFDQARFGAEVIRASPRQADLLVVSGTVFHKMAAPLLRLYEQMRAPRWVISMGACANSGGMYDVYSVVQGVDSFLPVDVYIPGCPPRPEAVLDALILLQQQVGAQRRPLGVTVGNAAGLGFEAPRRRDQRRDERMAQTLLDPPEKL

nuoB1

NADH-quinone oxidoreductase subunit B 1

205 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

22.879 kDa

MSWTIGRPGAEAPEDRMAASHLFTRLDDLVAWSRKHSLWPFNFGLSCCYVEMATALTPVYDQARFGAEVIRSTPRQADLLIVSGTVFRKMAVPLYRLYQQMREPRWVISMGACANSGGMYDIYSVVQGVDSFLPVDVYVPGCPPRPEALMEALVLLQSKIATEARPLQIRMGETGPARPFDPVPRRDALREGRMSVARLADPEST

nuoB1

NADH-quinone oxidoreductase subunit B 1

201 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

22.022 kDa

MGLSPNATTAGPRLPRPLVAPAATGILDPRTGRPVGADDRFFLEVNNELADKGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQMSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYAVVRGCDRIVPIDIYVPGCPPTAEALLYGVMLLQKKIRRTGTIER

nuoB1

NADH-quinone oxidoreductase subunit B 1

199 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

21.846 kDa

MIHVVDTVTEPVEIEQGIKIVPAANTIITTLDKIASWGRCSSLWPLTFGLACCAIEMMATAASHYDLDRFGIIMRATPRQADVMIIAGTVTKKMAPVIVNLYHQMPEPRYVIAMGSCACSGGIFNTYSTVQGVDEILPVDVYIPGCPPRPEALIEGLLKLQEKIKTEPHKKTGCLSGVCLIDKSQRRCSYESCRDNKKD

nuoB1

NADH-quinone oxidoreductase subunit B 1

198 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

21.799 kDa

MQPTPSQHPVGAQPLIARPATGIIDPNTGRPVGADDPFFLNVNRELSDKGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQLSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPIDIYVPGCPPTAEALLYGVMLLQKKIRRTGTIER

nuoB1

NADH-quinone oxidoreductase subunit B 1

198 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

21.799 kDa

MQPTPSQHPVGAQPLIARPATGIIDPNTGRPVGADDPFFLNVNRELSDKGFFVAATDDLITWARTGSLMWMTFGLACCAVEMMQLSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPIDIYVPGCPPTAEALLYGVMLLQKKIRRTGTIER

nuoB1

NADH-quinone oxidoreductase subunit B 1

194 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

21.295 kDa

MGVTPVSNEPLVAQQPKGIIDPSTGKPIGSNDAFFGEINNELADKGFLVTSTDELINWARTGSLMWMTFGLACCAVEMMQLSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPIDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIER

nuoB1

NADH-quinone oxidoreductase subunit B 1

194 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

21.294 kDa

MGVTPVSNQPLVAQQPKGIIDPSTGKPIGSNDAFFGEINNELADKGFLVTSTDELINWARTGSLMWMTFGLACCAVEMMQLSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPIDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIER

nuoB1

NADH-quinone oxidoreductase subunit B 1

194 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

21.481 kDa

MGEVKAGGPSTRVMEGSEHGFATTRVDALLNWAKKYSLFQYPFVTACCGMEYMAMASPRFDMARFGAEVPRFSPRQADLLWVVGTISQRQAPALKRIYEQMADPKWVLAFGTCASCGGFYDNYTTVAGIDKVIPCDVYVPGCPPRPEAVLDGLMLLQDKIARGDRTPAIVKPREDPAQTTEHLVTLQRKERSLP

nuoB1

NADH-quinone oxidoreductase subunit B 1

192 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

21.002 kDa

MELASGTTLVAPQPKGILDPATGKPIGSNDAFFGEINNELADKGFLVTSTDELINWARTGSLMWMTFGLACCAVEMMQMSMPRYDAERFGFAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPVDIYVPGCPPTAEALLYGVLLLQKKIRRTGTIER

nuoB1

NADH-quinone oxidoreductase subunit B 1

188 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

20.169 kDa

MQVPAVLGEPIRFVLNWGRRYSLWVFNFGLACCAIEFIATSMSRHDFMRLGVIPFAHGPRQADLMVVSGTVTDKMAPAIKRLYDQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQLIPVDVYVPGCPPRPEALLHGILRLQEKIAAEGAGVGGVSRPDALASPTGGAAPRSADSLTAPLVRPPTPS

nuoB1

NADH-quinone oxidoreductase subunit B 1

188 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

20.334 kDa

MQVPAVLGEPIRFVLNWGRRYSLWVFNFGLACCAIEFIATSMSRHDFMRLGVIPFAHGPRQADLMVVSGTVTDKMAPAIKRLYDQMPEPKYVISFGACSNCGGPYWDSYSVTKGVDQLIPVDVYVPGCPPRPEALLHGILRLQEKIAAEEAGVGGVSRPDALASPADALPPRAADSLTAPPVRPPDPS

nuoB1

NADH-quinone oxidoreductase subunit B 1

188 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

21.21 kDa

MSSFIQNQFEQNFITTNVDHVFNWARKSALWPLTFGLACCAIEMIASSTSRFDIARFGAEVFRPSPRQSDLMIVAGTVTLKMAPVLKRIWDQMPDPKWCISMGACSSVGGPFNTYAVLQGVDKIVPVDVYVTGCPPRPENLFYALLKLQDKIDTMTTLVKRPTEVRLDETMLEEFKQQIRIAQIQNPA

nuoB1

NADH-quinone oxidoreductase subunit B 1

186 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

20.745 kDa

MNAVQQPDIAWNRDHLDPGAEQEAVIRGITGEIAGKGFVVANLDRLVNWARTGSLWPMTFGLACCAVEMIHAYMPRWDLDRFGIIPRNSPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALVYGITQLQKKIRRTGTIFRE

nuoB1

NADH-quinone oxidoreductase subunit B 1

186 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

20.636 kDa

MSGQQGMGDGFLTTTLDAITNWGRANSIWPMPMGLSCCAIEMMAMAGPRYDIARFGAEVFRFSPRQSDLMIVAGTVTYKMATVVKKIWDQMPEPKWCIAMGACSSSGGMFRSYPVVQGIDQFLPVDVYVPGCPPRPDAVIHAVMEIQEKIKRQKDSFQDSFLAEDDAPQVRQPESPKEKEKLTVSE

nuoB1

NADH-quinone oxidoreductase subunit B 1

184 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

19.996 kDa

MGLEEKLPSGFLLTTVEQAAGWVRKASVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGSPRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFNNYAIVQGVDHIVPVDIYLPGCPPRPEMLIDAILKLHQKIQSSKLGVNAEEAAREAEEAALKALPTIEMKGLLR

nuoB1

NADH-quinone oxidoreductase subunit B 1

184 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

20.017 kDa

MGLEEKLPSGFLLTTVEQAAGWVRKSSVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGSPRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFNNYAIVQGVDHVVPVDIYLPGCPPRPEMLMDAILKLHQKIQSSKLGVNAEEAAREAEEAALKALPTIEMKGLLR

nuoB1

NADH-quinone oxidoreductase subunit B 1

184 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

20.025 kDa

MGLEEKLPSGFVLTTVEQAAGWVRKSSVFPATFGLACCAIEMMTTGAGRYDLARFGMEVFRGSPRQADLMIVAGRVSQKMAPVLRQVYDQMPNPKWVISMGVCASSGGMFNNYAIVQGVDHIVPVDIYLPGCPPRPEMLLDAILKLHQKIQTSKLGVNAEEAAREAEEAALKALPLIEMKGLLR

nuoB1

NADH-quinone oxidoreductase subunit B 1

182 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

20.128 kDa

MASELDGLPVIATRREEAEGFLQGLVSKSLGWARKYSLFTYPFVTACCGMEYMTMASARYDSDRFGAAMPRFSPRQADLLMVVGTVNCKQAPILQRIYEQMADPKWVMAFGVCASSGGFYDNYATVQGIDRIIPVDVYVPGCPPRPEQVLDGIMLLQKKIQNQSHKLIDRKPLPVIAGGPGR

nuoB1

NADH-quinone oxidoreductase subunit B 1

179 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

19.604 kDa

MGLEEKAGDLGIVTTTLEGVVNWGRTKAMWPMLFGLACCAIEMMAGQASNYDMSRFGLELMRASPRQADLMIVAGRVSRKMAPVLRRLYDQMPEPKWVVAMGDCASCGGVYNNYAIVQGVDEIVPVDVYVAGCPPRPEALIDGILQLHEKIKRDKITDHADGKPIRIEQAERGALKPLG

nuoB1

NADH-quinone oxidoreductase subunit B 1

178 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

19.949 kDa

MSLLDHKFGQGGIVVSQLEDVLNWARLSSLFPMSFGLACCAIEMMQTFTSGYDLDRFGVIPRPSPRQSDVMIVAGTVTFKMADRIRRLYEQMPEPRYVISMGSCSNCGGPYWEHGYHVVKGVDRIVPVDIYVPGCPPRPEALIGGFLKLQEKIRKETLVAPKAVERFLETHAKEKNIA

nuoB1

NADH-quinone oxidoreductase subunit B 1

176 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

19.641 kDa

MAMTGLNTAGSDRDYDTQSLNRELQDKGFLLTTTEDLINWARTGSLHWMTFGLACCAVEMMHTSMPRYDVERFGVAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIRRTGTITR

nuoB1

NADH-quinone oxidoreductase subunit B 1

176 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

19.641 kDa

MAMTGLNTAGSDRDYDTQSLNRELQDKGFLLTTTEDLINWARTGSLHWMTFGLACCAVEMMHTSMPRYDVERFGVAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIRRTGTITR

nuoB1

NADH-quinone oxidoreductase subunit B 1

174 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

19.123 kDa

MGIEEKAGNLGIVTTTLETVVNWGRTNAMWPLLFGLACCAIEMMGAQASNYDLSRFGMELNRASPRQADLMIVAGRVSRKMAPVVRRLYDQMPEPKWVIAMGDCAACGGIFNNYAIVQGVDEVVPVDVYVAGCPPRPEALIDGIMMLHQKVMREKLSGKKEAPIRIDQPLVQVK

nuoB1

NADH-quinone oxidoreductase subunit B 1

174 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

19.438 kDa

MTGLNTAGSDRDYDTQSLNRELQDKGFLLTTTEDLINWARTGSLHWMTFGLACCAVEMMHTSMPRYDVERFGVAPRASPRQSDVMIVAGTLTNKMAPALRKVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIRRTGTITR

nuoB1

NADH-quinone oxidoreductase subunit B 1

173 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

18.758 kDa

MAARMDPGIGGDVTLLHTSQLDNLINLARASSLYYLTFGLACCGIELMQTGGPRADVMRFGAIPRASPRQADFMIVAGTLTYKMAERARLLYDQMPEPKYVISMGSCSNCGGLFQLGYSVCKGVDKVIPVDVYVPGCPPRPEALTEGLLRLQEIVRSEPWSTKRRPAAQAEGA

nuoB1

NADH-quinone oxidoreductase subunit B 1

172 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

18.883 kDa

MTARTMDAGTGDVTLFHTSQLDKLINMARENSLWYLLFGLACCGIELMQFGGPRADVMRFGAIPRASPRQADFMIVAGTLTYKMAERAKLLYDQMPEPKYVISMGSCSNCGGLFQLGYSVCKGVDKVIPVDVYVPGCPPRPEALTEGLIRLQELIRSEPWATKRRPAKGSAA

nuoB1

NADH-quinone oxidoreductase subunit B 1

171 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

18.796 kDa

MVSSNTDLTYSSAIEGGIVVSKADAVINWIRTNSMWPMPMGLACCAIELMQVGNGRFDIARFGAEVMRFSPRQSDCMIVAGSVTYKMAPQIRRIYDQMMSPKWVIAMGACASSGGMYRSYAHMQGVDRILPVDVYISGCPPRPEGILDALMKLQAKIRTERAGQNLFKATV

nuoB1

NADH-quinone oxidoreductase subunit B 1

167 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

18.33 kDa

MGIEQKAGDMGIVTASLEQVVNWSRSNAMWPLLFGLACCAIEMMGAQGANYDLSRFGMEINRASPRQADLMIVAGRVSRKMAPVVRRLYDQMADPKWVIAMGDCAACGGVFNNYAIVQGVDEIVPVDVYVAGCPPRPEALIDGIIHLHEKVRRMRLDGTLREPVHLS

nuoB1

NADH-quinone oxidoreductase subunit B 1

166 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be a menaquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 20 kDa subunit family.

18.213 kDa

MSADGVFRDQGGFVTTTVDSFLRWAQSNSIWPLTFGLACCAIEMMNLASGPRYDIARFGSEAFRASPRQADLIFISGRVSNKMAPVIKRVYSQMLEPKWVVAFGACASSGGIFDNYAIMQGVDNLLPVDIYVPGCPPTPEAVIYAVQKLRDRIRKEDPRGGIIVRG

nuoB1

NADH-quinone oxidoreductase subunit B

163 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

18.476 kDa

MAMMEYLTTRKDELIGWVRKFSIFPYPFVTACCGMEFMAVASTLYDTDRFGAALPRFTPRQSDLLMVVGTITHKEAPVIKRVYDQMCDPKWVMAFGACATSGGVYRNYTVLQGVDRIIPVDIYIPGCPPRPEMVIDAIMKLQDKIAGERHPIFPYEKQNPVPV

nuoB1

NADH-quinone oxidoreductase subunit B 1

159 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.533 kDa

MSIEGVLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQSDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGVIQLQAKIRRTSTIARQ

nuoB1

NADH-quinone oxidoreductase subunit B 1

159 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.533 kDa

MSIEGVLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQSDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGVIQLQAKIRRTSTIARQ

nuoB1

NADH-quinone oxidoreductase subunit B 1

159 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.533 kDa

MSIEGVLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQSDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGVIQLQAKIRRTSTIARQ

nuoB1

NADH-quinone oxidoreductase subunit B 1

159 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.533 kDa

MSIEGVLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQSDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGVIQLQAKIRRTSTIARQ

nuoB1

NADH-quinone oxidoreductase subunit B 1

159 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.533 kDa

MSIEGVLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQSDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGVIQLQAKIRRTSTIARQ

nuoB1

NADH-quinone oxidoreductase subunit B 1

159 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.533 kDa

MSIEGVLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQSDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGVIQLQAKIRRTSTIARQ

nuoB1

NADH-quinone oxidoreductase subunit B 1

159 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.533 kDa

MSIEGVLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQSDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGVIQLQAKIRRTSTIARQ

nuoB1

NADH-quinone oxidoreductase subunit B 1

159 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.533 kDa

MSIEGVLKEGFVTTTADKLINWTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQSDVMIVAGTLCNKMAPALRRVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALVYGVIQLQAKIRRTSTIARQ

nuoB1

NADH-quinone oxidoreductase subunit B 1

158 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.48 kDa

MGIEGILEKGFVTTSIDTVVNWSRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGLLFRPSPRQSDLMIVAGTLVNKMAPALRKVYDQMPEPRWVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALIFGLIQLQKKIRRTNTIAR

nuoB1

NADH-quinone oxidoreductase subunit B 1

158 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.51 kDa

MSIEGVFREGFVTTSLDAVINWTRTGSLWPMTFGLACCAVEMIHAGCSRYDLDRFGVVFRPSPRQSDLMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALLYGIIQLQNKIKRTNTIAR

nuoB1

NADH-quinone oxidoreductase subunit B 1

158 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 20 kDa subunit family.

17.408 kDa

MGVEGILEKGFVTTTADKLINYTRTGSLWPMTFGLACCAVEMMHAGAARYDLDRFGVVFRPSPRQSDLMIVAGTLCNKMAPALRKVYDQMAEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALLYGIIQLQNKIKRTNTIAR