nubp1

Cytosolic Fe-S cluster assembly factor nubp1

321 amino acids

Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The nubp1-nubp2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins.

Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily.

34.112 kDa

MADVPNDAPEHCPGTSSDQAGKSSACQGCPNQSICASGATKAPDPAIEEIKQKMTSVKHKILVLSGKGGVGKSTFSAHLSHALASDSSKEVALLDVDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLAVMSIGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSIVQYLSGAGIDGAVIITTPQEVSLQDVRKEIRFCKKVNLPILGVIENMSGFVCPKCKNTSQIFPPTTGGAQRMCEELNLPLLGRIPLDPRIGKSCDEGKSFLTEVPDSPAAAAYQSIVQKIRDYCASHSASDDSC

NUBP1

Cytosolic Fe-S cluster assembly factor NUBP1

320 amino acids

Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery (PubMed:18573874). Required for maturation of extramitochondrial Fe-S proteins (PubMed:18573874). The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins (PubMed:18573874). Implicated in the regulation of centrosome duplication (By similarity). Negatively regulates cilium formation and structure (By similarity).

Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily.

34.534 kDa

MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS

Nubp1

Cytosolic Fe-S cluster assembly factor NUBP1

320 amino acids

Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins (By similarity). Implicated in the regulation of centrosome duplication (PubMed:16638812, PubMed:23807208). Negatively regulates cilium formation and structure (PubMed:23807208).

Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily.

34.085 kDa

MEEAPHGCPGADSAQAGRGASCQGCPNQRLCASGAGAAPDPAVEEIREKMKTVRHKLLVLSGKGGVGKSTFSAHLAHGLAEDGDTQVALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVDDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGDVDYLIVDTPPGTSDEHLSVVQYLAAAHIDGAVILTTPQEVALQDVRKEISFCHKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAEAMCQDLRIPLLGKVPLDPHIGKSCDKGQSFFVEAPDSPATAAYRSIIQRIRDFCNSHQSHAETLISP

Nubp1

Cytosolic Fe-S cluster assembly factor NUBP1

320 amino acids

Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Implicated in the regulation of centrosome duplication. Negatively regulates cilium formation and structure.

Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily.

34.045 kDa

MEGAPHGCPGADSAQAGRGASCQGCPNQKLCASGAGAAPDPAVEEIREKMKTVRHRILVLSGKGGVGKSTFSAHLAHGLAEDGDTQVALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGDVDYLVIDTPPGTSDEHLSVVQYLAAAHIDGAVILTTPQEVALQDVRKEISFCHKVKLPIIGVVENMSGFICPKCKRESQIFPPTTGGAEAMCQALKIPLLGKVPLDPHIGKSCDKGQSFFVEAPDSPATAAYKSIIQRIREFCNSRQSHDENLISP

nubp1

Cytosolic Fe-S cluster assembly factor nubp1

320 amino acids

Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The nubp1-nubp2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins.

Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily.

34.211 kDa

MADVPINAPQHCPGTGSTEAGKSSACQGCPNQSICASGTMSGPDPAIEEIKEKLSSVKHKILVLSGKGGVGKSTFSAHLAHGLAQDESKEVALLDVDICGPSIPKMMGLEGEQVHQSGSGWSPVYVEDNLAVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIIDTPPGTSDEHLSVVQYLSVAGIDGAVIITTPQEVSLQDVRKEINFCHKVKLPIIGVVENMSGFICPKCKNESQIFPPTTGGAEKMCTDLNVSLLGKVPLDPNIGKSCDTGKSFFSEIPDSPATLSYRTIIQRIQDYCEKKKVTCFS

NUBP1

Cytosolic Fe-S cluster assembly factor NUBP1

320 amino acids

Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The NUBP1-NUBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins. Implicated in the regulation of centrosome duplication. Negatively regulates cilium formation and structure.

Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily.

34.182 kDa

MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGAAADPAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQVALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVFLEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVQYLTAAHIDGAVIITTPQEVSLQDVRKEISFCHKVKLPIIGVVENMSGFICPKCQKESQIFPPTTGGAEAMCQDLKIPLLGKVPLDPRIGKSCDKGQSFLVEAPDSPATVAYRSIIQRIQEFCSQRLPEGENLVGS

nubp1

Cytosolic Fe-S cluster assembly factor NUBP1 homolog

315 amino acids

Component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. Required for maturation of extramitochondrial Fe-S proteins. The nubp1-nubp2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of an Fe-S cluster and its transfer to target apoproteins.

Belongs to the Mrp/NBP35 ATP-binding proteins family. NUBP1/NBP35 subfamily.

34.256 kDa

MSDQLVAPPPENCPGTQSEMSGKSAACAGCPNQQICATAPKGPDPDIIEIEERMKTVKNKILVLSGKGGVGKSTFSSQLSFALSMDEKVEVGLLDIDICGPSIPKIMGLEGENIHISGQGWDPVYVQDNLAVMSVGFLLEKEEDAVIWRGPKKNGIIKQFLKDVYWNDLDYLVIDTPPGTSDEHLSIVQYLKTSNLSGAVIVTSPQDVALIDVRKEINFCKKVGVPIIGVVENMSGFVCPKCNKESQIFIPTTGGAEKMSQDMNVPFLGRIPIDPLIARSCDEGKSYLITHPNSEATKQYNLIFNKIKEIVNNSK