About Services Proteins Contact

nrdG

Gene
nrdG
Protein
Anaerobic ribonucleoside-triphosphate reductase-activating protein
Organism
Pasteurella multocida (strain Pm70)
Length
158 amino acids
Function
Activation of anaerobic ribonucleoside-triphosphate reductase under anaerobic conditions by generation of an organic free radical, using S-adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine.
Similarity
Belongs to the organic radical-activating enzymes family.
Mass
18.181 kDa
Sequence
MNYVQYYPTDIVNGEGTRCTLFVSGCTHACRGCYNKKSWSFCAGLPFDEKMEAQILQDLKDTRIKRQGLTLTGGDPLHPRNLAVLLPFVKRVKHECPDKDLWVWTGYTLAELKADTLQRQILPYIDVLIDGKFEQDKADPSLVWRGSANQIIYRFTQY

Gene
NRDG
Protein
Anaerobic ribonucleoside-triphosphate reductase-activating protein
Organism
Enterobacteria phage T4
Length
156 amino acids
Function
Activation of anaerobic ribonucleoside-triphosphate reductase under anaerobic conditions by generation of an organic free radical, using S-adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine.
Similarity
Belongs to the organic radical-activating enzymes family.
Mass
18.247 kDa
Sequence
MNYDRIYPCDFVNGPGCRVVLFVTGCLHKCEGCYNRSTWNARNGQLFTMNTVKELASHLSKSYIQGLTLTGGDPLYPQNREEISNLVSWVKARFPEKDIWLWTGYKFEDIKQLEMLKYVDVIIDGKYEKNLPTKKLWRGSDNQRLWSNTDGVWKHD

Gene
nrdG
Protein
Anaerobic ribonucleoside-triphosphate reductase-activating protein
Organism
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Length
155 amino acids
Function
Activation of anaerobic ribonucleoside-triphosphate reductase under anaerobic conditions by generation of an organic free radical, using S-adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine.
Similarity
Belongs to the organic radical-activating enzymes family.
Mass
17.574 kDa
Sequence
MNYHQYYPIDVVNGPGTRCTLFVSGCVHQCKGCYNQSTWSLSSGHRYTQEMEDKIIADLKDTRIKRRGLSLSGGDPMHPANLSAVLQLVQRVKTECPDKDIWLWTGYTLAELDDSQQALLPYIDVLVDGKFIQEQADPGLEWRGSANQVIHRFTL

Gene
nrdG
Protein
Anaerobic ribonucleoside-triphosphate reductase-activating protein
Organism
Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Length
155 amino acids
Function
Activation of anaerobic ribonucleoside-triphosphate reductase under anaerobic conditions by generation of an organic free radical, using S-adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine.
Similarity
Belongs to the organic radical-activating enzymes family.
Mass
17.856 kDa
Sequence
MNYLQYYPTDVINGEGTRCTLFVSGCTHACKGCYNQKSWSFSAGVLFDDVMEQQIINDLKDTRIKRQGLTLSGGDPLHPLNVETLLPFVQRVKRECPDKDIWVWTGYKLDELDKQQRAMLPYIDVLIDGKFIQEQADPSLVWRGSANQIIHRFKL

Gene
nrdG
Protein
Anaerobic ribonucleoside-triphosphate reductase-activating protein
Organism
Salmonella typhi
Length
154 amino acids
Function
Activation of anaerobic ribonucleoside-triphosphate reductase under anaerobic conditions by generation of an organic free radical, using S-adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine.
Similarity
Belongs to the organic radical-activating enzymes family.
Mass
17.461 kDa
Sequence
MRYHQYYPVDIVNGPGTRCTLFVSGCVHECPGCYNKSTWRLNSGQPFTKEMEDKIIADLNDTRIHRQGISLSGGDPLHPQNVPDILALVQRIHAECPGKDIWVWTGYRLDELNAAQMQVVNLINVLVDGKFVQDLKDPALIWRGSSNQVVHHLR

Gene
nrdG
Protein
Anaerobic ribonucleoside-triphosphate reductase-activating protein
Organism
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Length
154 amino acids
Function
Activation of anaerobic ribonucleoside-triphosphate reductase under anaerobic conditions by generation of an organic free radical, using S-adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine.
Similarity
Belongs to the organic radical-activating enzymes family.
Mass
17.434 kDa
Sequence
MRYHQYYPVDIVNGPGTRCTLFVSGCVHECPGCYNKSTWRLNSGQPFTKEMEDKIIADLNDTRIHRQGISLSGGDPLHPQNVPDILALVQRIHAECPGKDIWVWTGYKLDELNAAQMQVVDLINVLVDGKFVQDLKDPALIWRGSSNQVVHHLR

Gene
nrdG
Protein
Anaerobic ribonucleoside-triphosphate reductase-activating protein
Organism
Escherichia coli O157:H7
Length
154 amino acids
Function
Activation of anaerobic ribonucleoside-triphosphate reductase under anaerobic conditions by generation of an organic free radical, using S-adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine.
Similarity
Belongs to the organic radical-activating enzymes family.
Mass
17.446 kDa
Sequence
MNYHQYYPVDIVNGPGTRCTLFVSGCVHECPGCYNKSTWRVNSGQPFTKAMEDQIINDLNDTRIKRQGISLSGGDPLHPQNVPDILKLVQRIRAECPGKDIWVWTGYKLDELNAAQMQVVDLINVLVDGKFVQDLKDPSLIWRGSSNQVVHHLR

Gene
nrdG
Protein
Anaerobic ribonucleoside-triphosphate reductase-activating protein
Organism
Escherichia coli (strain K12)
Length
154 amino acids
Function
Activation of anaerobic ribonucleoside-triphosphate reductase under anaerobic conditions by generation of an organic free radical, using S-adenosylmethionine and reduced flavodoxin as cosubstrates to produce 5'-deoxy-adenosine.
Similarity
Belongs to the organic radical-activating enzymes family.
Mass
17.446 kDa
Sequence
MNYHQYYPVDIVNGPGTRCTLFVSGCVHECPGCYNKSTWRVNSGQPFTKAMEDQIINDLNDTRIKRQGISLSGGDPLHPQNVPDILKLVQRIRAECPGKDIWVWTGYKLDELNAAQMQVVDLINVLVDGKFVQDLKDPSLIWRGSSNQVVHHLR