Nme6

Nucleoside diphosphate kinase 6

189 amino acids

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.

Belongs to the NDK family.

21.778 kDa

MTSILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRTRELQWKLEDCRRFYREHEGRFFYQRLVEFMTSGPIRAYILAHKDAIQLWRTLMGPTRVFRARYIAPDSIRGSLGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVHYSPEEGIHCAAETGGHKQPNKT

NME6

Nucleoside diphosphate kinase 6

186 amino acids

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Inhibitor of p53-induced apoptosis.

Belongs to the NDK family.

21.142 kDa

MASILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQRFYREHEGRFFYQRLVEFMASGPIRAYILAHKDAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA

nme6

Nucleoside diphosphate kinase 6

179 amino acids

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.

Belongs to the NDK family.

21.027 kDa

MSSFRWVRPLQLTLALIKPDAVANPVISEAVHQKILENNFLIIRHKELHWRSTDSQRFYCEHKGRFFYQRLVEFMSSGPMQAYILAHEDAVQLWRNLMGPTKVFRARIVAPGTVRGDLGLTDTRNTTHGSDSVESACREITFFFPEFNTSDWYEKQEPRYRTGPVFYDEERSEHRLEGE

nme6

Nucleoside diphosphate kinase 6

175 amino acids

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.

Belongs to the NDK family.

20.612 kDa

MRCVKALQLTLAVIKPDAMAHPLILEALHQKILENFIIIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFMSSGPMRAYILAREDAITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTRNTTHGSDSIESAKREISFFFPEFSAEEWMMREEPHFRLGHTEYNEESQIHTVKHT

Nme6

Nucleoside diphosphate kinase 6

175 amino acids

Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.

Belongs to the NDK family.

20.112 kDa

single

QLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWKPEDCRRFYREHEGRFFYQRLVEFMTSGPIRAYILAHKDAIQLWRTLMGPTRVFRARHIAPDSIRGSLGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVHYSPEEGIHCAAETGGPKPA