About Services Proteins Contact

ndrg4-a

Gene
ndrg4-a
Protein
Protein NDRG4-A
Organism
Xenopus laevis
Length
390 amino acids
Function
Contributes to the maintenance of intracerebral BDNF levels within the normal range. May enhance growth factor-induced ERK1 and ERK2 phosphorylation. May attenuate growth factor-promoted ELK1 phosphorylation in a microtubule-dependent manner (By similarity).
Similarity
Belongs to the NDRG family.
Mass
42.993 kDa
Sequence
MKLLGHKIELWAGLLLPDVSISGMSELRFPEEKPLLRGQDTEMESADTFLSAADTDWKEHDIETPYGMLHVVIRGTPKGNRPAILTYHDVGLNHKLCFNTFFNYEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQYPTMDQLAAMLPSVMQHFGFQSIIAIGVGAGAYVLAKFALIFPELVEGMVLINIDPNGKGWIDWAASKISGLASSLPETVLSHLFSQEELMNNTELVQNYRQQISNCVNQSNLQLFWNMYNSRRDLEMSRPGTAPNAKTLRAPVMLVVGDNAPAEECVVECNSKLDPTNTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPRPCTQSESSDGIGQINHTMEVSC