ndoA

Endoribonuclease EndoA

116 amino acids

Toxic component of a type II toxin-antitoxin (TA) system. Specific for 5'-UACAU-3' sequences, cleaving after the first U (PubMed:21763692). Yields cleavage products with 3' phosphate and 5' hydroxyl groups (PubMed:15882409). Cannot digest substrate with a UUdUACAUAA cleavage site (PubMed:24120662). Overexpression is toxic for cell growth (shown in E.coli), probably by inhibiting protein synthesis through the cleavage of single-stranded RNA. The toxicity is reversed by the antitoxin EndoAI. Toxin activity cannot be inhibited by MazE from E.coli. The EndoA-EndoAI complex does not seem to bind its own promoter (PubMed:24120662).

Belongs to the PemK/MazF family.

12.978 kDa

MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF

ndoA

Naphthalene 1,2-dioxygenase system, ferredoxin component

104 amino acids

Component of the naphthalene dioxygenase (NDO) multicomponent enzyme system which catalyzes the incorporation of both atoms of molecular oxygen into naphthalene to form cis-(1R,2S)-dihydroxy-1,2-dihydronaphthalene. Functions as an intermediate electron transfer protein via a specific interaction with iron sulfur protein components (ISP) (NdoB and NdoC).

Belongs to the bacterial ring-hydroxylating dioxygenase ferredoxin component family.

11.49 kDa

MTEKWIDAVALYEIPEGDVLGVTVEGKELALYEVEGEIYATDNLCTHGAARMSDGFLEGREIECPLHQGRFDVCTGRALCAPVTQNIKTYPVKIEGQRVMIDLS

ndoA

Naphthalene 1,2-dioxygenase system, ferredoxin component

104 amino acids

Component of the naphthalene dioxygenase (NDO) multicomponent enzyme system which catalyzes the incorporation of both atoms of molecular oxygen into naphthalene to form cis-(1R,2S)-dihydroxy-1,2-dihydronaphthalene (PubMed:6874638, PubMed:2294093, PubMed:10692370). Functions as an intermediate electron transfer protein via a specific interaction with iron sulfur protein components (ISP) (NdoB and NdoC) (PubMed:2294093). Also able to catalyze the cis-dihydroxylation of biphenyl and phenanthrene (PubMed:10692370).

Belongs to the bacterial ring-hydroxylating dioxygenase ferredoxin component family.

11.446 kDa

MTVKWIEAVALSDILEGDVLGVTVEGKELALYEVEGEIYATDNLCTHGSARMSDGYLEGREIECPLHQGRFDVCTGKALCAPVTQNIKTYPVKIENLRVMIDLS

ndoA

Naphthalene 1,2-dioxygenase system, ferredoxin component

87 amino acids

Component of the naphthalene dioxygenase (NDO) multicomponent enzyme system which catalyzes the incorporation of both atoms of molecular oxygen into naphthalene to form cis-(1R,2S)-dihydroxy-1,2-dihydronaphthalene. Functions as an intermediate electron transfer protein via a specific interaction with iron sulfur protein components (ISP) (NdoB and NdoC).

Belongs to the bacterial ring-hydroxylating dioxygenase ferredoxin component family.

9.563 kDa

single

DVLGVTVEGKDLALYEVEGEIYATDDLCTHGAARMSDGYLEGREIECPLHQGRFDVCTGRALCAPVTENIKTYAVKIENLRVMIDLS