ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

195 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

22.487 kDa

MKNNEKVSDSFLTSSGKELSEATPSASSYTTVVRDKNIKGVVSNWLAEMKLRHKPLGFDYQGVEILEVKPEDLTSVAIALYAYGFNYLRNQCAYDVSPGGNLASVYHLTKLDADVDQPQEVCLKVFLPRENPRVPSVFWIWKTADFQERESYDMFGIYYEGHPHLKRILMPENWVGWPLRKDYITPDFFELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

193 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

21.693 kDa

MSDSAPTNPTPTNPAPEESASAVATLEPGPVSQWLNTQGFDHDVLDPDHVGVEQIGVESAVLPIIVAAIKSHGFDYLQCQGGYDEGPGERLVCFYHFIAMAEQVEAMTAGRPHELREVRLKVFLSREGTPSLPSIYGLFRGADWQERETFDMYGIEFEGHPHPKRLLMPEDWKGWPLRKDYVQPDFYEMQDAF

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, organellar chromatophore

192 amino acids

NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient (By similarity).

Belongs to the complex I 30 kDa subunit family.

21.988 kDa

MIEPSIIPVLVENTEEKTFKFQPGQVSQWLTGQGLQHQILEPDLLGVELIGVEPSELQKIAEALKSNGFDYLQCQGGYDEGPGGRLVSFYHLIKLGTIADHYLTPNTLPPNSILKEVRLKVFLLRDGNLSVPSLYSIFRGSDWQERETFDMFGISYEGHPHPKRLLMPEDWKGYPLRKDYIQPDFYEMQVAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

188 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

21.052 kDa

MSETSKIPPASTEDTSAVVAPAAGPVSQWLQQQGFEHQALEPDHVGIEQIGVDAAVLPIIAAALKSNGFDYLQCHGGYDEGPGERLVCFYHLLAMAEQLEAMASDPAAQLREVRLKVFLSREGTPVLPSIYGLFRGADWQERETFDMYGIQFDGHPHPKRLLMPEDWKGWPLRKDYVQPDFYEMQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

188 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

21.119 kDa

MSETPSKQTAASDETGAVVAPEPGPVSQWLNKQGFDHNILEPDHLGVEQIGVDAAVLPMIAAALKSNGFDYLQCQGGYDEGPGEQLVCFYHLLAMAEQVEAMVADPSAKLREVRIKVFLNREGTPSLPSIYGLFRGADWQERETFDMYGIQFEGHPHPKRLLMPEDWKGWPLRKDYVQPDFYEMQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

185 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.885 kDa

MSETPSTPTVPAGPEPGPISRWLNKQGFEHQLLDPDHLGVEVIGVESMFLQVIVAALKADGFDYLQCQGGYDEGPGQQLVCFYHLVAMAEMVAKMGVGDSSSEAAKVREVRLKVFLSREDTPSLPSIYGLFRGADWQERETFDMFGINFEGHPHPKRLLMPEDWKGWPLRKDYVQPDFYEMQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

185 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.879 kDa

MSETPSTPPVPAGPEPGPVSRWLNQQGFEHQLLDPDHLGVEVIGVESMFLQVIVAALKADGFDYLQCQGGYDEGPGQQLVCFYHLVAMAEMVAKMGVGDSSSEAAKVREVRLKVFLSREDIPSLPSIYGLFRGADWQERETFDMFGINFEGHPHPKRLLMPEDWKGWPLRKDYVQPDFYEMQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

183 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

21.134 kDa

MAEENAQEKQAPPSAGEQSEPLVTLERGPVSQFLADNGFEHQYLGRDAAGVELLEVERDFLLPLCTALYAYGFNYLECQCGYDLGAGQPLVSLYHLIKLSDGADRPQEVRLQVKLPRQDPRLPSVYWIWKSADWQERETYDMYGIVFEGHPNLKRILMPEDWIGWPLRKDYITPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

183 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.821 kDa

MSPNSSEKQSSADVPVAASPQPGPVSQWLNQQGFDHDALEPDHLGVEQIGVEALFLQVITAALKSNGFDYLQCQGGYDEGPGERLVCFYHFVAMAELIDGKRDNLREVRLKVFLSREGEPSLPSIYGLFRGADWQERETFDMFGIHFEGHPHPKRLLMPEDWTGWPLRKDYVQPDFYEMQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

182 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.448 kDa

MSPTPDKQANADAPVAVAPAPGPVSQWLSQQGFEHELLEPDHVGVEQIAVEALFLPVIAAALKSHGFDYLQCQGGYDEGPGERLVCFYHLLAMAEVAEGSADQVREVRLKVFLSREGQPSVPSLYGLFRGADWQERETFDMFGIQFEGHPHPKRLLMPEDWTGWPLRKDYVQPDFYEMQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

182 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.553 kDa

MADSSSESTQDEQSVAEEQAAPIIEAGPVAKHLTQAGFTVEALGADHLGVEMIKVTADQLVDVATTLVNDGYNYLMCQGGYDSGPGQELVSMYHLLKLSDDADRPPEVRIKVFLSREDPRVPSLYWVWKASDWQERESYDMYGIVYEGHPNLTRILMPEDWVGWPLRKDYISPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

181 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.895 kDa

MTEDKAQQKPSSTAEPTEPLATLERGPVSQFLADNGFDHQYLGRDAAGVELLEVERDFLLPVCTALYAYGFNYLECQCGYDLGAGQPLVSLYHLIKLADGADRPQEVRVQVKLPRQDPRVPSVYWIWKSADWQERETYDMYGIIFEGHPNLKRILMPEDWIGWPLRKDYITPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

180 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

21.136 kDa

MNEETQTSELTNTDQGPQIEPGPISKWLNQKGLIHKLLEPDEIGIENLGVDPQQLFKIVSELKMNGFNYLQCQGGYDEGPGLSLVCFYHLMEMKDFNEGDKPREVRLKVFLDRNGSLRVPSLYKLFRGCDWQERETYDMFGINFDGHPHPKRLLMPEDWRGWPLRKDYIQPDFYEMQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

179 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.593 kDa

MAEEVNSPNEAVNLQEETAIAPVGPVSTWLTTNGFEHQSLTADHLGVEMVQVEADLLLPLCTALYAYGFNYLQCQGAYDEGPGKSLVSFYHLVKLTEDTRNPEEVRLKVFLPRENPVVPSVYWIWKAADWQERECYDMFGIVYEGHPNLKRILMPEDWVGWPLRKDYISPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

178 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.621 kDa

MVDENTQDNAPEQEEEAAIVQAGPVSSWLTENGFDHDLLEPDHLGVELIKVSPDFLVPLCTALYAYGFNYLQCQGAYDLGPGKELVSFYHLIKVSDNCEQAEEVRIKVFLPRDNPHIPSVYWIWKAADWQERESYDMYGIIYDGHPDLKRILMPEDWVGWPLRKDYVSPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

176 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.561 kDa

MEKEGLAKSSDTSIKKEGFISQSLSKDGIPNQSLPDDHIGIENISVEPNKLYEAVSNLRNYGFNYLQCQGGYDEGPGKNLVSFYHFITVDDFQKIEKIKEVRLKVFLKRDSDLSIPSLYKIFKGSDWQERETYDMYGINFIDHPNPTRLLMPEDWRGWPLRKDYIQPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

176 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.292 kDa

MAEEESKPVPAEKEESLVQAGKVSQWLTENGFDHEFLAPDKNGVEIIKVSADFLLPTATALYAYGFNYLQCQGGIDLGPGQELVSMYHLIKVGDNSDRPEEVRVKVFLPRENPVVPSVYWIWKTADWQERESYDMFGIIYEGHPNLKRLLMPEDWVGWPLRKDYISPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

176 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

19.515 kDa

MSETPTSPNQDLPEAPQAGPLSQWLTSQGFDHQILGNDHLGIERLGVEPLALPLVATALKSKGFDYLQVQGGFDQGPGEPLVSFYHLVQVGGSDGASTAEVRLEVSLARDGDLTVPSLYPLFRGADWQERETFDLFGINYSGHPHPKRLLMPEDWVGYPLRKDYVQPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

176 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.151 kDa

MEEQTTQSAADGQTAIELVTGPISDALKARGLPHELTGLDNRKIEIIKVEPEHLIAVARALYDDGFNYLACQCGFDEGPGDSLGSMYHLTKLSDSADRPPEVRIKVFLPRDNPRVPSVYWIWKTADWQERESFDMYGIIYEGHPNLIRILMPEDWVGWPMRKDYVTPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

176 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.695 kDa

MDQNNLSKSSEEIVEQRGIVSNRLYKDGITNNSLGNDHIGVELLSVKPEKLYEAISSLKKYGFNYLQCQGGYDEGPGKRLVSFYHLISLQDIEELEEIKEIRVKVFLNRDSDLSVPSLYKIFKGSDWQERETYDMYGINFQDHPNPKRILMPEDWRGWPLRKDYIQPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

176 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.252 kDa

MENNSSPESSEEIVKQNGIVSNQLSQDGITNESLGNDHIGVEILSVKPEKLYEAISTLRGYGFNYLQCQGGYDEGPGKCLVSFYHLISLGDIQDIKEIKEIRVKVFLNRDSDLSVPSLYKIFKGSDWQERETYDMFGINFADHPNPTRLLMPEDWRGWPLRKDYIQPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

176 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.449 kDa

MEKDSQATSSDTSIEKEGVISQSLSKDGIPNQSLSDDHIGIENISVQPSKLYEAVSALRNYGFNYLQCQGGYDEGPGKNLVSFYHFITVDDFQKIEKIKEVRLKVFLKRDSDLSIPSLYEIFKGSDWQERETFDMYGINFIDHPNPKRLLMPEDWRGWPLRKDYIQPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

175 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

19.893 kDa

MADEELQPVPAAEAAIVPSGPTSQWLTENGFAHESLAADKNGVEIIKVEADFLLPIATALYAYGFNYLQFQGGVDLGPGQDLVSVYHLVKVSDNADKPEEIRVKVFLPRENPVVPSVYWIWKTADWQERESYDMFGIIYEGHPNLKRILMPEDWVGWPLRKDYISPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

175 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

19.92 kDa

MADEELKPVPAAAEAIVPSGPTSQWLTENGFAHESLAADKNGVEIIKVEPDFLLPIATALYAYGFNYLQFQGGIDLGPGQDLVSVYHLVKVSDNADKPEEVRVKVFLPRENPVVPSVYWIWKTADWQERESYDMFGIIYEGHPNLKRILMPEDWVGWPLRKDYISPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

174 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

20.329 kDa

MAQLENNSTLLVRENELKGLVSNWLIEMKLMHRPLGFDYQGVETLEVKAQNLTSVAIALYAYGFNYLRSQCAYDVSPGGDLASVYHLTKVDDNADQPQEVCIKVFVPRTKPIIPSVFWIWKTADFQERESYDMFGIYYEGHPHLKRILMPEHWIGWPLRKDYITPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

174 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

19.945 kDa

MAEENQNPTPEEAAIVEAGAVSQLLTENGFSHESLERDHSGIEIIKVDADLLIPLCTALYAFGFNYLQCQGAYDLGPGKELVSFYHLLKVGDNVTDPEEVRVKVFLPRENPVVPSVYWIWKGADWQERESYDMYGIVYEGHPNLKRILMPEDWIGWPLRKDYVSPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

173 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.093 kDa

MTNDSEIVVEEKISGPISDWLSNKGFENIPLKEDHLGIEVIKISPNNLLSIVEALKNDGFNYLQCQGGYDEGPGLNIVCFYNLIEMNELKEDISPREVRLKVFLDRNGDLTVPSLYSLFRGADWQERETFDMYGVNFKGHPHPKRLLMPEDWKGWPLRKDYVQPDFYEMQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

173 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

20.071 kDa

MLNTYTDTPTRKTNEVQGRLSAWLAKHKLAHRPLGSDYQGIETLQIKSEDRASVAVALYVYGFNYLRSQCAYDVAPGGSLASVYHLTNIQDDADQPEEICIKVFVPRKNPRIPSIFWIWKSADFQERESYDMLGILHESHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

173 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

20.093 kDa

MTNDSEIVVEEKISGPISDWLSNNGFENIPLKEDHLGIEVIKISPNNLLTIVEALKNDGFNYLQCQGGYDEGPGLNIVCFYNLIEMNELKEDISPREVRLKVFLDRNGDLTVPSLYSLFRGADWQERETFDMYGVNFQGHPHPKRLLMPEDWKGWPLRKDYVQPDFYEMQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

172 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

19.829 kDa

MPEELTPTPETAVVEAGPVSRWLSENGFENTALERDHLGVEIVQVDREVLLPIAAALFAYGFNYLQCQGGYDLGPGQDLVSFYHLTKVSDDASQPQEVRVKVFLPRHDPKVPPVFWIWKGADWQERETFDMYGIQFEGHPNLKRILMPEDWVGWPLRKDYISPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

172 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

19.819 kDa

MPEELTPTPETAVVEAGPVSRWLSENGFENTALERDHLGVEIVQVDREVLLPIAAALFAYGFNYLQCQGGYDLGPGQDLVSFYHLTKVSDDASQPQEVRVKVFLPRHDPKVPSVFWIWKGADWQERETFDMYGIQFEGHPNLKRILMPEDWVGWPLRKDYISPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

170 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

20.052 kDa

MNTVDKEKFNLKTRGRLSAWLTKHNFSHRPLGYDYRGVEILEVKSEEWLSTAVALYAYGFNYLRSQCAYDATPGGSLVSVYHLTQMQDQSDQPEEICVKVFVSRTNPQIPSVYWVWKSAEFQERESYDMLGIIYQGHPYLRRILMPESWIGWPLRKDYVVPNFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

169 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

19.742 kDa

MLETFTNDTNEIQGRLSAWLIKHRLAHRPLGFDYQGVETLQVRSEDWLSIAVALYAYGFNYLRSQCVYDVAPGGLLASVYHLTKVQSNADQPEEVCIKIFVSRKNPKIPSVFWVWKGADFQERESYDMLGISYESHPRLKRILMPDSWIGWPLRKDYIVPNFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

169 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

19.902 kDa

MLNTYTNSSTKIQGRLSVWLANHKLPHRPLGFDYQGVEILQIRSEDWLSIAVALYVYGFNYLRSQCAYDVAPGGLLASVYHFTKIEDNVDQPEEICIKIFVSRQKPKIPSVFWIWKSADFQERESYDMLGISYENHPRLKRILMPDTWIGWPLRKDYIVPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

169 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

20.085 kDa

MLNILKNNNNKIQGRLSIWLIKHNLKHRPLGFDYQGIETLQIRSEDWPSLAVALYVYGFNYLRSQCAYDVEPGGLLASVYHFTKITDNADQPEEICIKIFILRKNPKIPSIFWVWKSADFQERESYDMFGIFYENHPCLKRILMPDSWLGWPLRKDYIVPNFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

169 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

19.615 kDa

MTNLAFQSSSQIQGRLSAWLVTHKLPHRPLGFDYQGVETIEVRPEDWPSVAVALYVYGFNYLRCQCAYDVAPGGALASVYHLTKVEDVADQPEELCVKLFVSRNNPSVPSSFWIWKSADFQERECYDMFGIVYKNHPHLKRILMPESWLGWPLRKDYITPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

169 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

19.763 kDa

MTDNFLSNSSQKQGRLSAWLTIHRLSHRPLGFDYQGVEIVEVRPEDWPSVAVSLYVYGFNYLRLQCGYDVFPGGPLASIYYLTKVQDGADQPEEVCIKIFVSRDNPKIPSAFWIWKSADFQERESYDMLGIIYESHPHLKRILMPESWLGWPLRKDYITPDFFELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

168 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

19.651 kDa

MLDLFNKTSQVQGRISAWLASNNLPHRPLGFDYQGVETLQIKPEDWPSIAVALYVNGFNYLRCQCGYDVYPGGPLASVYYLTKVDDNVDQPEEVCIKIFVPRENPKIPSIFWVWKTADYQERETYDMLGIVYESHPNLKRILMPESWLGWPLRKDYITPDFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

168 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

19.344 kDa

MSDTPEAPIVEAGPVGRLLQSQNLSVESLGRDASGVEMIKVDRDRLLAVCQTLYADGFNYLRCQAAYDSGPGQDLVSTYHLIKLSDNADRPPEVRIKVFVPRDDPRVPSVYWIWKTADWQERESYDMFGIVYEGHPNLKRILMPEDWVGWPLRKDYITPDFYELQEAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

167 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

19.278 kDa

MTEETTAIVQAGPTSIWLSENGFEHQALEADHSGVELIKVEADFLIPLATALYAYGFNYLQCQGAYDLGPGKELVSFYHLVKVTDNVDSPVEVRLKVFLPRDNPRVASVYWIWKAADWQERESYDMFGIIYEGHPHLKRILMPEDWVGWPLRKDYVSPEFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J

167 amino acids

NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient. Cyanobacterial NDH-1 also plays a role in inorganic carbon-concentration.

Belongs to the complex I 30 kDa subunit family.

19.475 kDa

MAESEAPIIEAGKVSKWLTDNGFDHEFLAPDHQGIEIIKGNRDFLIPLATALYAYGFNYLQCQCAYDAGPGEDLVSMYHLVKVSDDVEQPEEIRLKVFVPRDDPRLPSVYWIWKSADFQERESYDMYGIIYEGHPNLKRILMPEDWVGWPLRKDYISPEFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

165 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

19.44 kDa

MQSFLSVWLVKHGIIHRSLGFDYQGIETLQIKPEDWHSVAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVTRIEYGAYQPEEVCIKVFASRKNSRIPSVFWIWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYVAPHFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.696 kDa

MQQGWLSNWLVKHKVVHRSLGFDHRGIETLQIKAGDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWIWRSADFQERESYDMVGISYDNHPRLKRILMPESWVGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.783 kDa

MQQGWLSNWLVKHEVVHRSLGFDHRGIETLQIKAEDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWIWRSSDFQERESFDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.783 kDa

MQQGWLSNWLVKHEVVHRSLGFDHRGIETLQIKAEDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWIWRSSDFQERESFDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.783 kDa

MQQGWLSNWLVKHEVVHRSLGFDHRGIETLQIKAEDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWIWRSSDFQERESFDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.783 kDa

MQQGWLSNWLVKHEVVHRSLGFDHRGIETLQIKAEDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWIWRSSDFQERESFDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.659 kDa

MRGPLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASIYHLTRIEYGILDQPEEVCIKVFAPRKNPRIPSVFWVWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.659 kDa

MRGPLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASIYHLTRIEYGILDQPEEVCIKVFAPRKNPRIPSVFWVWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.711 kDa

MQQGWLSNWLVKHEVVHRSLGFDHRGIETLQIKAGDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWIWRSADFQERESYDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.669 kDa

MQQGWLSNWLVKHDVVHRSLGFDHRGVETLQIKAGDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWVWRSADFQERESYDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.711 kDa

MQQGWLSNWLVKHEVVHRSLGFDHRGIETLQIKAGDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWIWRSADFQERESYDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.711 kDa

MQQGWLSNWLVKHEVVHRSLGFDHRGIETLQIKAGDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWIWRSADFQERESYDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.669 kDa

MQQGWLSNWLVKHDVVHRSLGFDHRGVETLQIKAGDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWVWRSADFQERESYDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.669 kDa

MQQGWLSNWLVKHDVVHRSLGFDHRGVETLQIKAGDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWVWRSADFQERESYDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.669 kDa

MQQGWLSNWLVKHDVVHRSLGFDHRGVETLQIKAGDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFAQKDNPRIPSVFWVWRSADFQERESYDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

159 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.739 kDa

MQQGWLSNWLVKHEVVHRSLGFDHRGIETLQIKAGDWDSIAVILYVYGYNYLRSQCAYDVAPGGSLASVYHLTRIQYGIDNPEEVCIKVFVQKDNPRIPSVFWIWRSADFQERESYDMVGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.602 kDa

MQGTLSVWLAKRGLIHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVNQAEEVCIKVFMHRSNPRIPSVFWVWKSTDFQERESYDMLGITYDSHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.558 kDa

MQGTLSVWLAKRGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVNQAEEVCIKVFTHRSNPRIPSVFWVWKSTDFQERESYDMLGITYDSHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.595 kDa

MQGRLSAWLVKHGLIHRSLGFDYQGIETLQIKPEDWHSIAVIFYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEDGVDQPEEVCIKVFASRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.536 kDa

MQGTLSVWLAKRGLVHRSLGFDYQGIETLQIKPEDWDSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVNQAEEVCIKVFTHRSNPRIPSVFWVWKSTDFQERESYDMLGITYDSHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.58 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVISYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIQYGVDQPEEICIKVFTPRKNPRIPSVFWIWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.662 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWYSIAVISYVYGYNYLRFQCAYDVAPGGLLASVYYLTRIQYGVDQPEEVCIKVFAPRRNPKIPSVFWIWKSADFQERESYDMLGISYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.541 kDa

MQGTLSVWLAKRGLIHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVNPAEEVCIKVFTHRSNPRIPSVFWVWKSTDFQERESYDMLGITYDSHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.517 kDa

MQGHLSVWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFAPRSNPRIPSVFWVWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.598 kDa

MQGRSSAWLVKHELVHRSLGFDYQGIETLQIKPEDWYSIAVISYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIQYGVDQPEEVCIKVFAPRGNPRIPSVFWIWKSADFQERESYDMFGISYDNHPRLKRILMPESWIGWPLRKDYIAPDFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.676 kDa

MQGRLSAWLVKHELVHRSLGFDYQGIETLQIKPEDWYSIAVISYVYGYNYLRSQCAYDIAPGGLLASVYHLTRIQYGVDQPEEVCIKVFAPRRNPRIPSVFWIWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.565 kDa

MQGNLSAWLVKHGIVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYSLDQPEEVCIKVFAPRKNPRIPSIFWVWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.531 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSVAVILYIYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFAPRSNPKIPSVFWVWKSANFQERESYDMLGILYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.613 kDa

MQGRLSAWLVKHGLIHRSLGFDYQGIETLQIKSEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFVSRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYVAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.558 kDa

MQGTLSVWLAKRGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVNQAEEVCIKVFTHRSNPRIPSVFWVWKSTDFQERESYDMLGITYDSHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.312 kDa

MQGRLSAWLAKHKLAHRPLGFDYQGTETLQIKAEDWVSIAVALYVYGFNYLRSQCAYDVAPGGSLASVYHLTKINDNADQPEEVCIKVFVPREDPRIPSVLRIWKGANFQERESYDMLGIFYESHPCLKRILMPESWIGWPLRKDYIAPDFYEIQDSH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.541 kDa

MQGNLSSWLVKHGLVHRSLGFDYQGIETLQIKPEEWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGIDQPEEVCIKVFAARINPRIPSVFWVWKSADFPERESYDMLGIYYDNHPRLKRILMPESWVGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.592 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEEWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQAEEVCIKVFAPRNNPRIPSVFWVWKSADFQERESYDMLGIRYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.592 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEEWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQAEEVCIKVFAPRNNPRIPSVFWVWKSADFQERESYDMLGIRYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.592 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEEWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQAEEVCIKVFAPRNNPRIPSVFWVWKSADFQERESYDMLGIRYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.592 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEEWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQAEEVCIKVFAPRNNPRIPSVFWVWKSADFQERESYDMLGIRYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.581 kDa

MQGTLSVWLAKRGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVHQAEEVCIKVFTHRSNPRIPSVFWVWKSTDFQERESYDMLGITYDSHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.608 kDa

MQGRLSAWLVKHGLIHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFAPRRNPRIPSVFWVWKSVDFQERESYDMLGIFYATHPRLKRILMPESWVGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.622 kDa

MQGPLSAWLVKRRLVHRSLGFDYQGIETLEIKSEDWHSVAVILYVYGYNYLRSQCAYDVAPGGLLASVYHFTRIEYGIDQPEEVCIKVFLARSNPRIPSIFWVWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.609 kDa

MQGRLSSWLVKHGLIHRSLGFDYLGVETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGINQPEEVCIKIFVSRKNPRIPSIFWVWKSADFQEQESYDMLGISYDSHPRLRRILMPENWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.655 kDa

MQGRLSAWLVKHELVHRSLGFDYRGIETLQIKSEDWYSIAVILYAYGYNYLRSQCAYDAAPGGLLASVYHLTRIQYGIDQPEEVCIKVFVPRTNTRIPSVFWIWKSADFQERESYDMLGISYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.528 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKSEDWHSIAVISYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIQYGVDQPEEVCIKVFAARRNPRIPSVFWIWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.649 kDa

MQGRSSAWLVKHELVHRSLGFDYQGIETLQIKPEDWYSIAVISYVYGYNYLRSQCAYDVAPGGLLASVYHLTKIEYGVDQPEEVCIKVFAPRRNPRIPSVFWIWKSADFQERESYDMLGISYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.558 kDa

MQGTLSVWLAKRGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVNQAEEVCIKVFTHRSNPRIPSVFWVWKSTDFQERESYDMLGITYDSHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.639 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVSPGGLLASVYHLTRIECGIYQPEEVCIKIFVPRNNPRIPSIFWVWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.411 kDa

MQGRLSAWLVKHGLIHRSLGFDYQGIETLQIKPEAWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIECGIDQPEEVCIKVFVQGKILGIPSIFWVWKSADFQERESYDMLGISYYNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.683 kDa

MQGRLSAWLVKHGLVHRFLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGIDQPEEVCIKVFAPRKNPRIPSVFWVWKSADFQERESYDMLGIFYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.646 kDa

MQGRLSVWLIKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGIDQPEEVCIKVFAPRRNPRIPSVFWIWKSADFQERESYDMLGISYNNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.564 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVISYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIQYGVDQPEEVCIKVFAPRRNPRIPSVFWIWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.536 kDa

MQGTLSVWLAKRGLVHRSLGFDYQGIETLQIKPEDWDSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVNQAEEVCIKVFTHRSNPRIPSVFWVWKSTDFQERESYDMLGITYDSHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.595 kDa

MQGRLSAWLVKHGLIHRSLGFDYQGIETLQIKPEDWHSIAVIFYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEDGVDQPEEVCIKVFASRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.595 kDa

MQGRLSAWLVKHGLIHRSLGFDYQGIETLQIKPEDWHSIAVIFYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEDGVDQPEEVCIKVFASRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.599 kDa

MQGRSSAWLVKHELVHRSLGFDYQGIETLQIKPEDWYSIAVISYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIQYGVDQPEEVCIKVFVPRSNPRIPSVFWIWKSADFQERESYDMLGISYDNHPRMKRILMPESWVGWPLRKDYIAPNFYELQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.625 kDa

MQGRSSAWLVKHELVHRSLGFDYQGVETLQIKPEDWYSIAVISYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIQYGVDQPEEVCIKVFVPRSNPRIPSVFWIWKSADFQERESYDMLGISYDNHPRMKRILMPESWIGWPLRKDYIAPNFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.592 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEEWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQAEEVCIKVFAPRNNPRIPSVFWVWKSADFQERESYDMLGIRYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.595 kDa

MQGRLSAWLVKHGLIHRSLGFDYQGIETLQIKPEDWHSIAVIFYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEDGVDQPEEVCIKVFASRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.557 kDa

MQGYLSAWLVKHGLIHRSLGFDYQGIETFQIKSEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIKYGVDQPEEVCIKVFATRRDPRIPSVFCVWKSVDFQERESYDMLGISYDNHPRLKRILMPDSWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.567 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFASRRNPRIPSVFWVWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.575 kDa

MQGRLSAWLVKHGLIHRSLGFDYQGIETLQIKPEDWHSIAVILYIYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFSPRKNPRIPSVFWVWKGVDFQERESFDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.718 kDa

MQSRLSDWLVKHELVHRSLGFDYQGIETLQIKTEDWDSIAVISYIYGYNYLRSQCAYDVAPGGFLASVYHLTRIQYGIDKVEEVCLKVFVSRNNPRIPSVFWIWKSADFQERESYDMLGISYANHPHLKRILMPESWIGWPLRKDYITPNFYEIQDAR

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.591 kDa

MQGTLSVWLAKRGLIHRSLGFDYQGIETLQIKPEDWHAIAVILYVYGYNYLRLQCAYDVAPGGLLASVYHLTRIEYGVNQAEEVCIKVFTQRSNPRIPSVFWVWKSTDFQERESYDMLGITYDSHPRLKRILMPESWMGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.676 kDa

MQGRLSAWLVKHELVHRSLGFDYQGIETLQIKPEDWYSIAVISYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIQYGVDQPEEVCIKVFAPRRNPRIPSVFWIWKSADFQERESYDMLGISYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.608 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFAPRRNPRIPSVFWIWKSADFQERESYDMLGICYDTHPRLKRILMPETWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.715 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVEPGGLLASVYHLTRIESGVDQPEEVCIKVFVPRRNPRIPSVFWVWKSVDFQERESYDMLGIFYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.566 kDa

MQGRLSVWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFAPRSNPRIPSVFWVWKSSDFQERESYDMLGISYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.566 kDa

MQGRLSVWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFAPRSNPRIPSVFWVWKSSDFQERESYDMLGISYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.52 kDa

MQGNLSAWLVKHALIHRSLGFDYQGIETLQIKPGDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFAPRRDPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.492 kDa

MQGNLSAWLVKHALIHRSLGFDYQGIETLQIKPGDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFAPRKDPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.667 kDa

MQGRLSAWLVKHELVHRSLGFDYQGIETLQIKPEDWHSIAVISYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIQYGVDQPEEVCIKVFAKRRNPRIPSVFWIWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.585 kDa

MQGRLSAWLVKRGLIHRSLGFDYQGIETLQIKPKDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGGDQPEEVCIKVFASRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.501 kDa

MQGHLSAWLVKHGLIHRSLGFDYQGIETLQIKPGDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGADQPEEVCIKVFAPRRDPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.681 kDa

MQSHLSAWLVKHELVHRSLGFDYQGIETLQIKPEDWDSIAVISYVYGYNYLRSQCAYDVAPGGFLASVYHLTRIQYGVDQPEEVCIKVFVPRENPIVPSVFWVWRSADFQERESYDMFGISYDNHPRLKRILMPESWIGWPLRKDYITPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.558 kDa

MQGTLSVWLAKRGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVNQAEEVCIKVFTHRSNPRIPSVFWVWKSTDFQERESYDMLGITYDSHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.551 kDa

MQGRVSVWLSQHKLAHRPSGFDYQGIEIIQIKSEDWPSIAVALYIYGFNYLRSQCAYDVMPGGFLASVYHLTKLQDNADQPEEVCIKILVSRESPKIPSIFWVWKSADFQERESYDMSGIHYESHPRLKRILMPESWIGWPLRKDYVVPNFYELQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.661 kDa

MQGRLSAWLAKHRLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIQYGVDQPEEVCIKVFAPRRNPRIPSVFWIWKSADFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.623 kDa

MQGRLSAWLVKHGLIHRSLGFDYQGIETLQIKPEDWHSIAVIFYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEDGVDQPEELCIKVFASRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQEAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.565 kDa

MQGRLSAWLVKHGLIHRSLGFDYQGIETLQIKPEDWHSIAVIFYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEDGVAQPEELCIKVFASRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.667 kDa

MQGRLSAWLVKHGLIHRSLGFDYQGIETLQIKPEDWHSIAVIFYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEDDVDQPEELCIKVFASRRNPRIPSVFWVWKSVDFQERESYDMLGISYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.623 kDa

MQGRLSSWLVKHGLIHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRLEYGIDQPEEVCIKIFVARKNPRIPSIFWVWKSADFQEKESYDMLGISYDNHPRLRRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.665 kDa

MQGRLSAWLVKHGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVDQPEEVCIKVFAPRRNPRIPSVFWVWKSADFQERESYDMFGISYDNHPRLKRILMPESWIGWPLRKDYIVPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.674 kDa

MQGRLSAWLVKHELVHRSLGFDYQGIEILQIKPEDWDSIAVISYVYGYNYLRSQCAYDVAPGGFLASVYHLTRIQYGVDQPEEVCIKVFAPRRNPKIPSVFWIWRSADFQERESYDMLGISYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.674 kDa

MQGRLSAWLVKHELVHRSLGFDYQGIEILQIKPEDWDSIAVISYVYGYNYLRSQCAYDVAPGGFLASVYHLTRIQYGVDQPEEVCIKVFAPRRNPKIPSVFWIWRSADFQERESYDMLGISYENHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.518 kDa

MQGTLSVWLAKRGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVNQAEEVCIKVFTHRSNSRIPSVFWVWKSADFQERESYDMLGITYDSHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.548 kDa

MQGTLSVWLAKRGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVNQAEEVCIKVFTHRSNSRIPSVFWVWKSTDFQERESYDMLGITYDSHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.775 kDa

MQGRLSAWLVKHELVHRSLGFDYQGIETLQIKSEDWYSIAVISYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIQYGVDQPEEVCIKVFAQRRNPRIPSVFWIWKSSDFQERESYDMLGIYYDNHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAH

ndhJ

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

158 amino acids

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and possibly in a chloroplast respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient.

Belongs to the complex I 30 kDa subunit family.

18.593 kDa

MQGRLSAWLAKHQLAHRPLGFDYQGIEILQIRPQDWPSIAVALYVYGFNYLRSQCAYDVTPGGGLASVYHLTKVQDDADQPEEVCIKIFVSREDPRIPSVFWIWKSSDFQERESYDMFGIIYESHPRLKRILMPESWIGWPLRKDYIVPNFYELQDAY