About Services Proteins Contact

ndh-6

Gene
ndh-6
Protein
NADH-ubiquinone oxidoreductase chain 6
Organism
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Length
243 amino acids
Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone (By similarity).
Similarity
Belongs to the complex I subunit 6 family.
Mass
26.68 kDa
Sequence
MNSLFLINESFTNGYISSVLDIISILAIFCGISVIVNKNPIISVLFLIGLFASVSSYLILLGLSFIGLAYLIVYIGAISILFLFILMLINIRISELQSNTNNSIPLTIILGISLSYSLFQLLPYDIAILSNFSSNINNNLYNLSMNKQNNGNFGINTTPAVSLQPKNNDLLFVTSKIWDGNLAESNHITTIGNVMYSNYSIWLFLASFILLLAMVGSIVIIMKSNASWGGALPNTRETKTEGR