ncbp-2

Nuclear cap-binding protein subunit 2

158 amino acids

Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing and RNA-mediated gene silencing (RNAi). The CBC complex is involved in miRNA-mediated RNA interference and is required for primary microRNAs (miRNAs) processing. In the CBC complex, ncbp-2 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires ncbp-1 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure (By similarity).

Belongs to the RRM NCBP2 family.

18.438 kDa

MVFDPRTLDNPKEISAYRDQRYQGTVRDQETALRTSCTLYVGNLSYYTKEDQVYELFGRAGDVRRVIMGLDRFKKTPCGFCFVEYYTREDAELALQNISNTRMDDRVIRADWDAGFIEGRQYGRGKHGGQVRDEYRKDYDPERGGYNRAIAQKGGDRQ

ncbp-2

Nuclear cap-binding protein subunit 2

157 amino acids

Component of the cap-binding complex (CBC), which binds co-transcriptionally to the 5' cap of pre-mRNAs and is involved in various processes such as pre-mRNA splicing and RNA-mediated gene silencing (RNAi). The CBC complex is involved in miRNA-mediated RNA interference and is required for primary microRNAs (miRNAs) processing. In the CBC complex, ncbp-2 recognizes and binds capped RNAs (m7GpppG-capped RNA) but requires ncbp-1 to stabilize the movement of its N-terminal loop and lock the CBC into a high affinity cap-binding state with the cap structure (By similarity).

Belongs to the RRM NCBP2 family.

18.355 kDa

MVFDPRTLDQPKDISAYRDQRYQGSVRDQELALRTSCTLYVGNLSYYTKEDQVYELFGRAGDVRRVIMGLDRFKKTPCGFCFVEYYTREDAELALQNISNTRMDDRVIRADWDAGFVEGRQYGRGKHGGQVRDEYRKDYDPERGGYNRAIAQKSMVE