Mtap

S-methyl-5'-thioadenosine phosphorylase

289 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

32.018 kDa

MITIKCKDTNLDPLPVKIGIIGGSGLDDPDILEQRQERVVETPYGEPSDALIEGEINGVQCVLLARHGRKHDIMPSNVNYRANIWALRDVGCTHLIVSTACGSLREEIKPGNLVVPHDFIDRTTKRLQTFYDGKAQSPRGVCHLPMFPAFSERTRNILLQAAKELEIPAHDKATIVTIEGPRFSSRSESHMFRQWGGDLINMTTCPEVVLAKEAGLLYGSVAIATDYDCWRMGCEGVNVQDVLRTFAENVIKVKKILVNAVGRIAKEDWSEDILNAKQCVCNNTMSGAM

MTAP

S-methyl-5'-thioadenosine phosphorylase

283 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

31.256 kDa

MSSGATPAAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALVLGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLKEEIQPGDIIIIDQFIDRTTRRLQTFYDGNHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMITIEGPRFSSRAESIMFQTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSMEWSETLHNMKKMAQFSVLLPRH

MTAP

S-methyl-5'-thioadenosine phosphorylase

283 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

31.236 kDa

MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH

MTAP

S-methyl-5'-thioadenosine phosphorylase

283 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

31.236 kDa

MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLLPRH

Mtap

S-methyl-5'-thioadenosine phosphorylase

283 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

31.062 kDa

MASGSACTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDMVIIDQFIDRTSLRPQTFYDGSHCSARGVCHIPMAEPFCPKTREVLIETAKKLGLRCHSKGTIVTIEGPRFSSRAESLIFRTWGADVVNMTTVPEVVLAKEAGICYASIAMATDYDCWKEHEEAVSVDGVLKTMKENANKAKSLLLTTIPQIGSMEWSETLRNLKNMAQFSVLPPRH

mtap

S-methyl-5'-thioadenosine phosphorylase

281 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

30.699 kDa

MAGVCAVKVGIIGGSGLDDPDILEGRLEKYVDTPFGKPSDALVLGKIKNVDCVLLASRHGRQHTIAPTNVNYRANIWALKSEGCTHILVTTACGSLREEIQPGDIVIVDQFIDRTTKREQTFYDGGPSCLPGVCHIPMAEPFCAKTREVLIDIAKRLGIKCHSKGAMITIEGPRFSSKAESQMFRLWGADVINMTTVPEVILAKEAGICYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKATSILLTAIPQIAAMDWTELLQSMKSTVQLSVMLPKH

mtap

S-methyl-5'-thioadenosine phosphorylase

280 amino acids

Catalyzes the reversible phosphorylation of S-methyl-5'-thioadenosine (MTA) to adenine and 5-methylthioribose-1-phosphate. Involved in the breakdown of MTA, a major by-product of polyamine biosynthesis. Responsible for the first step in the methionine salvage pathway after MTA has been generated from S-adenosylmethionine. Has broad substrate specificity with 6-aminopurine nucleosides as preferred substrates.

Belongs to the PNP/MTAP phosphorylase family. MTAP subfamily.

30.847 kDa

MTSNSHVKIGIIGGSGLDDPDILEGRTERYVVTPYGKPSDALILGKIKNVDCVLLARHGRQHTIMPTNVNYQANIWALKEEGCTHLLVTTACGSLREDIQPGDIVLIDQFIDRTTKRVQTFYDGQPTSPPGVCHIPMAEPFCSKTREVLLEVAQGLGVKCHTRGTMVTIEGPRFSSRAESLMFRQWGADVINMTTVPEVVLAKEAGLCYASIAMATDYDCWKEHEEAVCVDNVLKTMKENANKASSILLTAIPQICQMDWDSTINAHKSMSQSSVMLPKH