msrA2

Peptide methionine sulfoxide reductase MsrA 2

222 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

24.358 kDa

MALFGFGKKLALPTPEKALPGRAQIMPVPANHYVNKNPLKPPFPDGFEKALFGLGCFWGAERKFWQQQGVYSTAVGYAAGFTPNPTYDEVCTGLTGHNEVVLVVFDPKVISYTQLLKVFWESHNPTQGMRQGNDVGTQYRSGIYVYSEAQKQLAEASRDAYQQALSSAGYEKITTEILDAPEFYYAEAYHQQYLAKNPNGYCGLGGTNVACPVGVFESSANG

msrA2

Peptide methionine sulfoxide reductase MsrA 2

214 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

23.605 kDa

MGLAIAVGSFLISPFSKVIPDPVVDINPVSTTARGTEKAVFAGGCFWGLEAMFEEVRGVKDVQTGYSGGTEATANYARVSGGGTDHAESIEIVYDPAQVSYGELLKIFFSVGHDPTQVNRQGVDQGRQYRSAIFATTPEQKQVAQAYIDQLEESQAFDQAIATEVNDFDAFYPAEDYHQDFVQRNPAHPYVLVHDLPKLRKFRQQYSDKLKAQS

msrA2

Peptide methionine sulfoxide reductase MsrA 2

198 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

22.136 kDa

MLRLLFGFLVTCFLLLPARAAEPQYAIFAGGCFWCVESDFDAVPGVLETISGYAGGKSANPTYEDYAKGGHREVVRVKFDPDRVSYAELVGVLFRTTDPTDGDGQFCDRGFAYTTAIHALNERQAMDAKAEKIKAEAELGRPIVTPVEGAAKFWPAEDYHQDFGKRNPIRYWYYRNGCGRNRTVEKLWGDRAYAGVSH

msrA2

Peptide methionine sulfoxide reductase MsrA 2

196 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

21.916 kDa

MRRLIVLFAAALAVLGATAPALAAPKTETAVFAGGCFWCMEHDMQGVPGVLKVESGYTGGHLKNPTYRDVTSETSGHYEAVRVTYDPAKLDYGFLLYRYWRLVDPTDDGGQFCDRGPSYRPAVFVTPAQRPIAEKSRTEAAKRLKTGTMKTQILPAQTFYLAEEYHRDYAKRNKLNYFAYRTGCGRDARLKQVWGG

msrA2

Peptide methionine sulfoxide reductase MsrA 2

195 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

21.351 kDa

MDEKAAPGSETAIFAGGCFWGVQGVFQHVKGVSKAVSGYTGGAKDDAVYETVGTGRTGHAESVEITYDPSKVTYGQLLQVYFSVAHNPTQLNFQGPDSGTQYRSTIFAENDTQKQIAQSYIDQLDKAKLYPAPIVTTIETGKTFYPAENYHQDFLTLNPTYPYIVYNDLPKVANLKQLFPALYSEKPVLVLSASN

msrA2

Peptide methionine sulfoxide reductase MsrA 2

177 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

20.588 kDa

MTKEYATLAGGCFWCMVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNQTGHVEAVQITFDPEVTSFENILDIYFKTFDPTDDQGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQGIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVHYYQYQRGSGRKAFIESHWGNQNA

msrA2

Peptide methionine sulfoxide reductase MsrA 2

177 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

20.588 kDa

MTKEYATLAGGCFWCMVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNKTGHVEAVQITFDPEVTSFENILDIYFKTFDPTDDQGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQGIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVHYYQYQRGSGRKAFIESHWGNQNA

msrA2

Peptide methionine sulfoxide reductase MsrA 2

177 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

20.588 kDa

MTKEYATLAGGCFWCMVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNKTGHVEAVQITFDPEVTSFENILDIYFKTFDPTDDQGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQGIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVHYYQYQRGSGRKAFIESHWGNQNA

msrA2

Peptide methionine sulfoxide reductase MsrA 2

177 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.

Belongs to the MsrA Met sulfoxide reductase family.

20.559 kDa

MTKEYATLAGGCFWCMVKPFTSYPGIKSVVSGYSGGHADNPTYEQVCTNQTGHVEAVQITFDPEVTSFENILDIYFKTFDPTDDQGQFFDRGESYQPVIFYHDKHQKKAAEFKKQQLNEQGIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVHYYQYQRGSGRKAFIESHWGNQNA

msrA2

Peptide methionine sulfoxide reductase MsrA 2

177 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.

Belongs to the MsrA Met sulfoxide reductase family.

20.588 kDa

MTKEYATLAGGCFWCMVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNQTGHVEAVQITFDPEVTSFENILDIYFKTFDPTDDQGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQGIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVHYYQYQRGSGRKAFIESHWGNQNA

msrA2

Peptide methionine sulfoxide reductase MsrA 2

177 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

20.588 kDa

MTKEYATLAGGCFWCMVKPFTSYPGIKSVVSGYSGGHVDNPTYEQVCTNQTGHVEAVQITFDPEVTSFENILDIYFKTFDPTDDQGQFFDRGESYQPVIFYHDEHQKKAAEFKKQQLNEQGIFKKPVITPIKPYKNFYPAEDYHQDYYKKNPVHYYQYQRGSGRKAFIESHWGNQNA

msrA2

Peptide methionine sulfoxide reductase MsrA 2

172 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

19.878 kDa

MATERAIFAGGCFWCMVQPFEEREGILSVISGYTGGNVENPTYEQVKKHLTGHTEAVEIIFDNSKITYQSLVELYWTLTDPTDAFGQFEDRGDNYRPVIFVENEEQEKIAKESKAQLQASGNFDSPIVTSIETVQKFWPAEDYHQGFYKKNPEDYAQSSKIRHDFLEKQWKK

msrA2

Peptide methionine sulfoxide reductase MsrA 2

168 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.

Belongs to the MsrA Met sulfoxide reductase family.

19.1 kDa

MTERAVLAGGCFWGMQDLIRKLPGIESTRVGYTGGEVPNATYRNHGNHAEGIEILFDPEKTSYRQLLEFFFQIHDPTTPNRQGNDRGPSYRSAIYYVDEEQKQIALDTIADVNASGLWPGKVVTEVEPVSDFWEAEPEHQDYLEKVPNGYTCHFPRPNWVLPKRAATE