msrA1

Peptide methionine sulfoxide reductase MsrA 1

222 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

24.209 kDa

MGFFDLFGKKTAMVAPNEALPGRSATMPVPDKHFVNGNPLKAPFPQGMETALFGLGCFWGAERKFWQIPGVYSTAVGYAAGYTPNPTYQEVCTGMTGHNEVVLVAFDPQQVSYDQLLKVFWESHNPTQGMRQGNDVGTQYRSGIYTYSEAQQQAALASKQAYQQALQQAGYGEITTEILPAPDFYYAEDYHQQYLAKNPNGYCGLGGTNVACPIGTEVSLGA

msrA1

Peptide methionine sulfoxide reductase MsrA 1

217 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

23.044 kDa

MLSLHKTLEMPSADTALPGRAAPIPTAQTHFVNGHALKGPYPEGLETAIVAMGCFWGVERVFWKVPGVYVTAAGYAAGITPNPTYEEVCTGRTGHTEVVLVVFDPKVVTYEALLKTFWENHDPTQGMRQGNDIGTQYRSGLYVTSDAQAAAAAESKAAYQQALSARGLGTITTEIAPAGPFYFAEDYHQQYLAKNPNGYCGIGGTGVVCPIGLGVEG

msrA1

Peptide methionine sulfoxide reductase MsrA 1

217 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

24.015 kDa

MFLIDMFNKKTILPDAATALPGREEEIPTATTHFVSGRPLQGPYPEGMKKVLFGMGCFWGAERLLWEIPGVYVTAAGYSGGLTPNPTYQETTTGLTGHTEVVLVVYDPAKVSLQRLLKTFFEEHDPTQGMRQGNDVGTTYRSAIYVYDEEQLAEANAARNAFQKALRVYNHDREITTEIAKAGPFYFAEDYHQQYLAKNPDGYCGLRGTGVSCPIGA

MSRA1

Peptide methionine sulfoxide reductase A1

202 amino acids

Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRA family specifically reduces the MetSO S-enantiomer (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

22.898 kDa

MNILNKLGIGSSRQTNMDPSPIAQVIDDEAPAPGNQFTQFGAGCFWSVELAYQRVPGVTQTEVGYSQGITHDPSYKDVCSGTTNHAEIVRVQYDPKECSYQSLLDLFWSKHDPTTLNRQGNDVGTQYRSGIYFYNPEQEKLARESLERHQQQVDRKVVTEILPAKKFYRAEEHHQQYLSKGGRFGLKQSTEKGCNDPIRCYG

msrA1

Peptide methionine sulfoxide reductase MsrA 1

192 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.

Belongs to the MsrA Met sulfoxide reductase family.

21.782 kDa

MPFDSEIVEVKTRPGEEVATLAGGCFWCTEAVFERMEGVNDVVSGYIGGKIKNPNYKQVCGKMTGHAEAVQIYYDPSKTNFEELLKVFFKTHDPTTLNRQGADGGPQYRSSIFVHNDEQREIAKKTMEKLGEEYRDPIVTLIEPATKFYVAEEYHQDYYRRNPNAGYCQAVVAAKVRKFNRNFGDKIKGSGK

msrA1

Peptide methionine sulfoxide reductase MsrA 1

183 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

21.331 kDa

MSTERAIFAGGCFWCMVEPFEERPGILAVTSGYTGGHIEYPTYDQVLSKASGHTEAVEILFDNELISYDELLDIYWSLIDPTDADGQIYDRGANYRPVIFVESEEQRIAAQKSKIALEKSGIWDKPIVVPIEEAKTFWPAEEYHQQYYKKDPKRYQAMHKARERYLALQRFKGKFKFLRKNTR

msrA1

Peptide methionine sulfoxide reductase MsrA 1

172 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

19.28 kDa

MATSTERAVLAGGCFWGMQDLIRRYPGVISTRVGYSGGDVANATYRNHGTHAEAIEINFDPAVISYRTLLERFFQIHDPTTRNRQGNDVGMSYRSAIYYTSDEQKRVAEDTIADVDASGLWPGKVVTEVAPAGAFWEAEPEHQDYLEKYPNGYTCHFVRPGWKLPVREKAVS

msrA1

Peptide methionine sulfoxide reductase MsrA 1

169 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.

Belongs to the MsrA Met sulfoxide reductase family.

19.611 kDa

MNINTAYFAGGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVIDPLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNPERYAEEQKIRQEYKNKQ

msrA1

Peptide methionine sulfoxide reductase MsrA 1

169 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine.

Belongs to the MsrA Met sulfoxide reductase family.

19.611 kDa

MNINTAYFAGGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVIDPLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNPERYAEEQKIRQEYKNKQ

msrA1

Peptide methionine sulfoxide reductase MsrA 1

169 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

19.611 kDa

MNINTAYFAGGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVIDPLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNPERYAEEQKIRQEYKNKQ

msrA1

Peptide methionine sulfoxide reductase MsrA 1

169 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

19.611 kDa

MNINTAYFAGGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVIDPLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNPERYAEEQKIRQEYKNKQ

msrA1

Peptide methionine sulfoxide reductase MsrA 1

169 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

19.611 kDa

MNINTAYFAGGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVIDPLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNPERYAEEQKIRQEYKNKQ

msrA1

Peptide methionine sulfoxide reductase MsrA 1

169 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

19.611 kDa

MNINTAYFAGGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVIDPLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNPERYAEEQKIRQEYKNKQ

msrA1

Peptide methionine sulfoxide reductase MsrA 1

163 amino acids

Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sulfoxide in proteins to methionine (By similarity).

Belongs to the MsrA Met sulfoxide reductase family.

18.524 kDa

MELKIGSTEAPMEKATFGAGCFWGVEAAFRKVKGVVSTSVGYMGGHFPNPCYLDVLSRITGHAEVVQIEYDPQLVSYEDLLAVFWDIHDPTTLNRQGPDKGEQYRSVIFFHNEQQAEAAQQSKAKVQVSGRFELDIVTEIKHKSEYYLATEEHQQYFEKQAKR