Organism
Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
Function
A backup porin induced when MspA, the major porin, is deleted. Probably forms a water-filled channel which favors the permeation of cations. There are about 2400 porins in wild-type, 800 in an mspA deletion and 150 in a double mspA-mspC deletion. A triple mspA-mspC-mspD deletion mutant has low but detectable channel activity. Different conductance values with maxima at 2.3 and 4.6 nanosiemens might be caused by a simultaneous reconstitution of MspB channels into the membrane or by the existence of different MspB conformations.
Similarity
Belongs to the mycobacterial porin (TC 1.B.24) family.
Sequence
MTAFKRVLIAMISALLAGTTGMFVSAGAAHAGLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGFPWSLGVGINFSYTTPNILIDDGDITAPPFGLNSVITPNLFPGVSISADLGNGPGIQEVATFSVDVSGPAGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN